Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-Caspase 9 (Cleaved-Asp353) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Caspase 9 (Cleaved-Asp353) Antibody: A synthesized peptide derived from human Caspase 9 (Cleaved-Asp353)

Rabbit Polyclonal Anti-VDAC2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-VDAC2 antibody: A synthesized peptide derived from human VDAC2

VDAC1 (N-term) rabbit polyclonal antibody, Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human VDAC1.

Tyrosine Hydroxylase (TH) (N-term) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide - KLH conjugated

Goat Anti-Tyrosine Hydroxylase Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-VQDELDTLAHAL, from the C Terminus of the protein sequence according to NP_954986.2; NP_000351.2; NP_954987.2.

Rabbit Polyclonal OMI Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen OMI antibody was raised against a peptide corresponding to 16 amino acids near the C-terminus of human Omi.

Rabbit Anti-Tyrosine Hydroxylase Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SDS-denatured, native rat tyrosine hydroxylase purified from pheochromocytoma

Rabbit polyclonal Tyrosine Hydroxylase (Ab-19) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Tyrosine Hydroxylase around the phosphorylation site of serine 19 (A-V-SP-E-Q).

Rabbit polyclonal Synuclein-pan antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human synuclein.

Rabbit polyclonal Caspase 9 (Thr125) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of threonine 125 (P-E-TP-P-R).
Modifications Phospho-specific

Rabbit polyclonal anti-COX6C antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human COX6C.

Rabbit polyclonal anti-UBE1L / UBA7 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human UBE1L.

Rabbit polyclonal Tyrosine Hydroxylase (Ser19)(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Tyrosine Hydroxylase around the phosphorylation site of serine 19 (A-V-SP-E-Q).
Modifications Phospho-specific

Rabbit polyclonal anti-ATP5D antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ATP5D.

Rabbit polyclonal anti-ATP5G3 antibody

Applications IF, IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ATP5G3.

Rabbit polyclonal anti-GPR37 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GPR37.

Rabbit polyclonal anti-NDUFA4 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NDUFA4.

Rabbit polyclonal anti-NDUFA8 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NDUFA8.

Rabbit polyclonal anti-COX42 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human COX42.

COX7A2 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen COX7A2 antibody was raised against synthetic peptide from human COX7S/A2 (aa1-50).

Anti-COX6B2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 1-89 amino acids of human cytochrome c oxidase subunit VIb polypeptide 2 (testis)

Anti-ATP5J rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Anti-ATP5J rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit polyclonal SLC25A31 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This SLC25A31 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 139-167 amino acids from the Central region of human SLC25A31.

Rabbit polyclonal SLC25A6 Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This SLC25A6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 128-155 amino acids from the Central region of human SLC25A6.

Rabbit polyclonal UCHL1 Antibody (C-term)

Applications IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen This UCHL1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 187-214 amino acids from the C-terminal region of human UCHL1.

Rabbit polyclonal CASP9 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This CASP9 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 183-211 amino acids from the Central region of human CASP9.

Rabbit polyclonal Parkin antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Parkin antibody.

Rabbit polyclonal COX41 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human COX41.

Ubiquitin B Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human Ubiquitin B

Rabbit anti-NDUFS5 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NDUFS5

Rabbit anti-ATP5B Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ATP5B

Rabbit Polyclonal Anti-UBA1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UBA1 antibody: synthetic peptide directed towards the N terminal of human UBA1. Synthetic peptide located within the following region: MEAGPPGSARPAEPGPCLSGQRGADHTASASLQSVAGTEPGRHPQAVAAV

Rabbit Polyclonal Anti-UQCRFS1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UQCRFS1 antibody: synthetic peptide directed towards the N terminal of human UQCRFS1. Synthetic peptide located within the following region: MLSVASRSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFL

Rabbit Polyclonal Anti-SLC25A6 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC25A6 antibody: synthetic peptide directed towards the N terminal of human SLC25A6. Synthetic peptide located within the following region: LQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSFWRGNLANVIRYFPTQ

Rabbit Polyclonal Anti-SLC18A1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC18A1 antibody is: synthetic peptide directed towards the N-terminal region of Human SLC18A1. Synthetic peptide located within the following region: FKEVNSSLHLGHAGSSPHALASPAFSTIFSFFNNNTVAVEESVPSGIAWM

Rabbit Polyclonal Anti-NDUFV2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Ndufv2 antibody: synthetic peptide directed towards the C terminal of human Ndufv2. Synthetic peptide located within the following region: DNYYEDLTPKDIEEIIDELKAGKVPKPGPRSGRFCCEPAGGLTSLTEPPK

Rabbit Polyclonal Anti-NDUFV2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Ndufv2 antibody is: synthetic peptide directed towards the N-terminal region of Ndufv2. Synthetic peptide located within the following region: GAGGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHQAAAVLPV

Rabbit Polyclonal Anti-ATP5G2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP5G2 antibody: synthetic peptide directed towards the N terminal of human ATP5G2. Synthetic peptide located within the following region: SRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQTSAISRDIDTA

Rabbit Polyclonal Anti-LCMT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LCMT2 antibody: synthetic peptide directed towards the C terminal of human LCMT2. Synthetic peptide located within the following region: PVLSDWHFLHVGTMAWVRIPVEGEVPEARHSHSACTWQGGALIAGGLGAS

Rabbit Polyclonal Anti-APAF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-APAF1 Antibody: A synthesized peptide derived from human APAF1

Rabbit Polyclonal Anti-Parkin Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Parkin Antibody: A synthesized peptide derived from human Parkin

Rabbit Polyclonal Anti-PGP9.5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PGP9.5 Antibody: A synthesized peptide derived from human PGP9.5

Rabbit Polyclonal Anti-UBE1L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UBE1L Antibody: A synthesized peptide derived from human UBE1L

Rabbit Polyclonal Anti-PARK7 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PARK7 Antibody: A synthesized peptide derived from human PARK7

Rabbit Polyclonal Anti-COX42 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-COX42 Antibody: A synthesized peptide derived from human COX42

Rabbit Polyclonal Anti-COX6C Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-COX6C Antibody: A synthesized peptide derived from human COX6C

Rabbit Polyclonal Anti-COX IV antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-COX IV antibody: A synthesized peptide derived from human COX IV

Rabbit Polyclonal Anti-PGP9.5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PGP9.5 Antibody: A synthesized peptide derived from human PGP9.5