Germany
Japan
United Kingdom
China
Primary Antibodies
Download
IL12A mouse monoclonal antibody, Azide Free
| Applications | ELISA, IF, WB |
| Reactivities | Human |
Rabbit Polyclonal Antibody against RAC1 (S71)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 49-78 amino acids from human RAC1. |
Rabbit Polyclonal PI3-kinase p85- alpha (Tyr607) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PI3-kinase p85- alpha around the phosphorylation site of Tyrosine 607 |
| Modifications | Phospho-specific |
IFNAR2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IFNAR2 |
Rabbit Polyclonal Anti-RAC1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAC1 antibody: synthetic peptide directed towards the middle region of human RAC1. Synthetic peptide located within the following region: LAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL |
Rabbit Polyclonal antibody to interferon alpha Receptor 1 (interferon (alpha, beta and omega) receptor 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 3 and 240 of interferon alpha Receptor 1 (Uniprot ID#P17181) |
Rabbit polyclonal IRF-3 (Ser386) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IRF-3 around the phosphorylation site of serine 386 (A-S-SP-L-E). |
| Modifications | Phospho-specific |
Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C). |
| Modifications | Phospho-specific |
Rabbit polyclonal CASP8 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CASP8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 432-461 amino acids from the C-terminal region of human CASP8. |
Rabbit polyclonal IL8 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the C-terminal region of human IL8. |
Rabbit Polyclonal JNK1/2/3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 |
Rabbit polyclonal p38 MAPK (Ab-322) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human p38 MAPK around the phosphorylation site of tyreonine 322 (D-P-Y-D-Q). |
Rabbit polyclonal p38 Antibody
| Applications | WB |
| Reactivities | Bovine, Canine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Pig |
| Conjugation | Unconjugated |
| Immunogen | A 20 residue synthetic peptide based on the human p38 with the cysteine residue added and coupled to KLH. |
Mouse Monoclonal NAK Antibody (108A429)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine |
| Conjugation | Unconjugated |
TA336453 is a replacement of AM08296PU-N.
Rabbit Polyclonal Anti-MAPK10 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat, Tobacco hornworm |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Mapk10 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: RYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYREL |
IL12A (alpha + beta) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, WB |
| Reactivities | Human |
| Immunogen | Highly pure (>98%) recombinant hIL-12 (human Interleukin-12) |
Rabbit Polyclonal Antibody against PIK3R1 (N-term L11)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human PI3KR1. |
Rabbit Polyclonal Antibody against AKT2 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This AKT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-123 amino acids from the N-terminal region of human AKT2. |
Rabbit polyclonal COT (Ab-290) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human COT around the phosphorylation site of threonine 290 (R-G-TP-E-I). |
Active filters
Pathways
- Toll-like receptor signaling pathway
Filter by
Target Symbol
- MAP2K1 (237)
- JUN (183)
- MAP2K3 (158)
- AKT1 (127)
- CD40 (125)
- CD80 (103)
- MAPK13 (99)
- MAPK1 (74)
- FOS (64)
- PIK3CG (64)
- CD86 (62)
- TNF (60)
- MAPK8 (55)
- RELA (54)
- STAT1 (52)
- CD14 (47)
- PIK3R5 (47)
- AKT2 (44)
- IL6 (42)
- IKBKG (41)
- MAPK14 (41)
- IRF3 (40)
- SPP1 (39)
- MAP2K4 (38)
- NFKB1 (36)
- PIK3CD (35)
- RIPK1 (35)
- MAP2K2 (34)
- MYD88 (32)
- MAPK9 (31)
- IL12A (30)
- NFKBIA (30)
- IKBKE (28)
- CHUK (26)
- CXCL8 (26)
- MAP3K8 (25)
- PIK3CA (25)
- IL1B (23)
- MAPK3 (23)
- TLR8 (22)
- IL12B (21)
- IRF5 (21)
- IKBKB (20)
- AKT3 (19)
- CASP8 (19)
- MAPK10 (19)
- MAP3K7 (17)
- TLR4 (17)
- CCL5 (16)
- PIK3R1 (14)
- TOLLIP (14)
- IRAK1 (13)
- TLR3 (13)
- TLR2 (12)
- CCL3 (11)
- FADD (11)
- IFNB1 (10)
- MAP2K6 (10)
- TLR7 (10)
- TRAF6 (10)
- CXCL10 (9)
- MAPK12 (9)
- TICAM1 (8)
- TLR5 (8)
- TLR9 (8)
- IFNA2 (7)
- IRAK4 (7)
- LY96 (7)
- MAPK11 (7)
- TAB1 (7)
- TIRAP (7)
- TLR6 (7)
- TRAF3 (7)
- IFNA6 (6)
- IFNAR1 (6)
- IRF7 (6)
- RAC1 (6)
- TBK1 (6)
- TLR1 (6)
- MAP2K7 (5)
- PIK3CB (4)
- PIK3R3 (4)
- TAB2 (4)
- CCL4 (3)
- CXCL11 (3)
- IFNAR2 (3)
- LBP (3)
- TICAM2 (3)
- CXCL9 (2)
- IFNA16 (2)
- IFNA4 (2)
- PIK3R2 (2)
- C FOS (1)
- IFNA1 (1)
- IFNA13 (1)
- IFNA17 (1)
- IFNA5 (1)
- IFNA7 (1)
- IFNA8 (1)
Reactivities
- Human (2581)
- Mouse (1728)
- Rat (1651)
- Dog (515)
- Monkey (438)
- Bovine (20)
- Canine (12)
- Chicken (11)
- Pig (11)
- Primate (8)
- Xenopus (7)
- Rabbit (6)
- Cow (5)
- Hamster (5)
- Drosophila (4)
- Rhesus Monkey (3)
- C. elegans (2)
- Canis (2)
- Equine (2)
- Guinea Pig (2)
- Macaque (2)
- Porcine (2)
- Sheep (2)
- Bat (1)
- Chimpanzee (1)
- Feline (1)
- Gerbil (1)
- Gibbon (1)
- Gorilla (1)
- Orang-Utan (1)
- Squirrel (1)
- Tobacco hornworm (1)
- X. tropicalis (1)
- Zebrafish (1)