TOLLIP Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TOLLIP |
TOLLIP Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TOLLIP |
Rabbit Polyclonal Anti-JUN Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human JUN |
Rabbit Polyclonal Anti-MAP2K1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MAP2K1 |
IL12A mouse monoclonal antibody, Azide Free
Applications | ELISA, IF, WB |
Reactivities | Human |
Rabbit Polyclonal Antibody against RAC1 (S71)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This RAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 49-78 amino acids from human RAC1. |
Rabbit Polyclonal Caspase-8 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Caspase-8 antibody was raised against a 16 amino acid peptide from near the carboxy-terminus of human Caspase-8 isoform A. |
Rabbit Polyclonal TLR9 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TLR9 antibody was raised against a peptide corresponding to 15 amino acids near the center of human TLR9. |
Rabbit polyclonal anti-TNFA antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TNFA. |
Mouse IRAK Monoclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal PI3-kinase p85- alpha (Tyr607) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PI3-kinase p85- alpha around the phosphorylation site of Tyrosine 607 |
Modifications | Phospho-specific |
Rabbit anti-MEK1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | C term -peptide of human MEK1 |
Rabbit anti-MyD88 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MyD88 |
IFNAR2 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IFNAR2 |
MAP2K7 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MAP2K7 |
Rabbit anti-MAP2K6 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MAP2K6 |
Rabbit Polyclonal NFkB1/NFkB p105 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A genomic peptide made to an N-terminal region of the human NFkB p105/p50 protein (within residues 400-590). [Swiss-Prot P19838] |
Rabbit Polyclonal Anti-RAC1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RAC1 antibody: synthetic peptide directed towards the middle region of human RAC1. Synthetic peptide located within the following region: LAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL |
Mouse Monoclonal IL8 Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal c-jun Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
MAPK1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI6F8
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700062 |
c Fos (FOS) (4-17) rabbit polyclonal antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
IRAK (IRAK1) mouse monoclonal antibody, clone 3A9
Applications | ELISA, IF, IHC, IP, RNAi, WB |
Reactivities | Human |
JNK1 (MAPK8) (318-427) mouse monoclonal antibody, clone 3H2, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Human |
IFNAR1 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide, corresponding to amino acids 410-460 of Human IFN-R1. |
Rabbit Polyclonal TIRAP Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TIRAP antibody was raised against a peptide corresponding to 15 amino acids near the C-terminus of mouse TIRAP. |
Rabbit Polyclonal TLR1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | TLR1 antibody was raised against a peptide corresponding to 16 amino acids near the amino terminus of human TLR1. |
Rabbit Polyclonal antibody to interferon alpha Receptor 1 (interferon (alpha, beta and omega) receptor 1)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 3 and 240 of interferon alpha Receptor 1 (Uniprot ID#P17181) |
Rabbit polyclonal anti-CD40 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human CD40. |
Rabbit polyclonal IRF-3 (Ser386) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IRF-3 around the phosphorylation site of serine 386 (A-S-SP-L-E). |
Modifications | Phospho-specific |
Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C). |
Modifications | Phospho-specific |
Rabbit polyclonal CASP8 Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CASP8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 432-461 amino acids from the C-terminal region of human CASP8. |
Rabbit polyclonal IL8 Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This IL8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the C-terminal region of human IL8. |
Rabbit Polyclonal JNK1/2/3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 |
Rabbit polyclonal p38 MAPK (Ab-322) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human p38 MAPK around the phosphorylation site of tyreonine 322 (D-P-Y-D-Q). |
Rabbit polyclonal p38 Antibody
Applications | WB |
Reactivities | Bovine, Canine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Pig |
Conjugation | Unconjugated |
Immunogen | A 20 residue synthetic peptide based on the human p38 with the cysteine residue added and coupled to KLH. |
Mouse Monoclonal NAK Antibody (108A429)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Canine |
Conjugation | Unconjugated |
Mouse Monoclonal TLR9 Antibody (26C593.2)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat, Canine, Equine, Primate |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-MAPK10 Antibody - N-terminal region
Applications | WB |
Reactivities | Rat, Tobacco hornworm |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Mapk10 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: RYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYREL |
Mouse Monoclonal AKT(pan) Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Mouse Monoclonal AKT1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Mouse Monoclonal IkB-alpha (N-terminus) Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
TLR3 (514-657) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | TLR3 antibody was raised against recombinant protein fragment containing a sequence corresponding to a region within amino acids 514 and 657 of TLR3. |
IL12A (alpha + beta) goat polyclonal antibody, Aff - Purified
Applications | ELISA, FN, WB |
Reactivities | Human |
Immunogen | Highly pure (>98%) recombinant hIL-12 (human Interleukin-12) |
Interferon beta (IFNB1) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Immunogen | Highly purified (>98%) E.coli derived recombinant Human Inferferon beta. |
Rabbit Monoclonal Antibody against MAP2K4 (Clone EP615Y)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against PIK3R1 (N-term L11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This PI3KR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human PI3KR1. |
Rabbit Polyclonal Antibody against AKT2 (N-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This AKT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-123 amino acids from the N-terminal region of human AKT2. |
Rabbit Polyclonal Akt1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Akt1 antibody was raised against a 16 amino acid peptide from near the amino-terminus of human Akt1. |
Rabbit Polyclonal TLR9 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | TLR9 antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human TLR9. |
Rabbit polyclonal COT (Ab-290) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human COT around the phosphorylation site of threonine 290 (R-G-TP-E-I). |