Germany
Japan
United Kingdom
China
Primary Antibodies
Download
Collagen I (COL1A1) rabbit polyclonal antibody, Biotin
| Applications | ELISA, FC, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian, Mouse, Rat |
| Conjugation | Biotin |
| Immunogen | Collagen Type I from Human and Bovine placenta. |
CD61 (ITGB3) mouse monoclonal antibody, clone VIPL2, Aff - Purified
| Applications | FC, IHC, WB |
| Reactivities | Human, Primate |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Collagen II (COL2A1) mouse monoclonal antibody, clone 2G2/49 (COLL-II), Ascites
| Applications | ELISA, IF, WB |
| Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rat, Sheep |
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
TA349205 is a possible alternative to TA349208.
Rabbit anti-MYL2 (Myosin light chain 2, Phospho-Ser18) polyclonal antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized phosphopeptide derived from humanMyosin Light Chain 2 around the phosphorylation site of serine 18 (A-T-SP-N-V). |
| Modifications | Phospho-specific |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 3C2-4
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 3G11-14
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 4A5-19
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 5F4-15
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 5G12-21
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 6F5-23
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 6H8-22
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 8E8-2
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 8F6-6
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 9G5-20
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 12G4-15
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 15C4-8
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 16F12-11
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
USD 525.00
5 Days
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
Rabbit Polyclonal VEGFR2 (Tyr1214) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human VEGFR2 around the phosphorylation site of Tyrosine 1214 |
| Modifications | Phospho-specific |
Active filters
Pathways
- Focal adhesion
Filter by
Target Symbol
- ERBB2 (239)
- MAP2K1 (237)
- EGFR (207)
- JUN (183)
- CTNNB1 (162)
- AKT1 (127)
- VWF (106)
- BRAF (100)
- BCL2 (99)
- MAPK1 (74)
- PARVA (71)
- MET (64)
- PIK3CG (64)
- PDGFRA (63)
- MAPK8 (55)
- KDR (53)
- VEGFA (53)
- PDGFRB (50)
- PXN (49)
- HRAS (47)
- PIK3R5 (47)
- AKT2 (44)
- BIRC3 (44)
- VASP (43)
- CCND2 (42)
- PTK2 (41)
- SPP1 (39)
- ACTB (38)
- EGF (38)
- LAMB3 (38)
- CCND1 (37)
- ITGB3 (35)
- PIK3CD (35)
- RAF1 (33)
- PARVB (32)
- SHC1 (32)
- FN1 (31)
- HGF (31)
- IGF1 (31)
- MAPK9 (31)
- BCAR1 (30)
- SRC (30)
- IGF1R (29)
- COL1A1 (28)
- FLT4 (27)
- ITGB1 (27)
- PRKCA (27)
- MYL7 (26)
- PAK1 (26)
- PIK3CA (25)
- FLT1 (24)
- RAPGEF1 (24)
- VEGFB (24)
- VEGFD (24)
- MAPK3 (23)
- PTEN (23)
- PAK4 (22)
- BAD (21)
- CAV1 (21)
- GSK3B (20)
- AKT3 (19)
- MAPK10 (19)
- LAMA4 (18)
- COL6A1 (17)
- COL4A1 (16)
- PDGFB (16)
- ACTN1 (15)
- ELK1 (15)
- ROCK2 (15)
- PIK3R1 (14)
- VCL (14)
- ITGA6 (13)
- ITGAV (13)
- CAPN2 (12)
- COL3A1 (12)
- COL5A1 (12)
- FYN (12)
- PPP1CA (12)
- PRKCB (12)
- GRB2 (11)
- ILK (11)
- ITGA4 (11)
- PDGFA (11)
- VAV1 (10)
- VEGFC (10)
- ITGA2 (9)
- ITGA5 (9)
- MYL9 (9)
- PDPK1 (9)
- PGF (9)
- RHOA (9)
- ACTN2 (8)
- CCND3 (8)
- COL1A2 (8)
- COL2A1 (8)
- CRK (8)
- FLNA (8)
- ITGB4 (8)
- PAK2 (8)
- TNC (8)
Reactivities
- Human (3588)
- Mouse (2965)
- Rat (2832)
- Dog (535)
- Monkey (517)
- Bovine (43)
- Chicken (36)
- Pig (21)
- Rabbit (18)
- Cow (14)
- Canine (13)
- Xenopus (12)
- Hamster (10)
- Rhesus Monkey (9)
- Canis (8)
- Drosophila (8)
- Horse (8)
- Primate (7)
- Sheep (5)
- X. tropicalis (5)
- Bat (4)
- Porcine (4)
- Zebrafish (4)
- Guinea Pig (3)
- C. elegans (2)
- Chimpanzee (2)
- Gorilla (2)
- All Species (1)
- Avian (1)
- Baboon (1)
- Broad (1)
- Feline (1)
- Fish (1)
- Gibbon (1)
- Goat (1)
- Orang-Utan (1)
- Tobacco hornworm (1)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Families
- Druggable Genome (3887)
- Protein Kinase (1791)
- ES Cell Differentiation/IPS (1550)
- Transmembrane (1097)
- Secreted Protein (671)
- Transcription Factors (379)
- Adult stem cells (281)
- Stem cell relevant signaling - JAK/STAT signaling pathway (274)
- Stem cell - Pluripotency (263)
- Cancer stem cells (207)
- Phosphatase (49)
- Embryonic stem cells (43)
- Induced pluripotent stem cells (43)
- Protease (43)
- Stem cell relevant signaling - DSL/Notch pathway (37)
- Stem cell relevant signaling - Wnt Signaling pathway (37)