Primary Antibodies

View as table Download

Anti-HES1 mouse mAb, clone OTI4H1, DyLight488 conjugated

Applications FC
Reactivities Human
Conjugation DyLight 488

Anti-HES1 mouse mAb, clone OTI4H1, Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

Anti-HES1 mouse mAb, clone OTI4H1, HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

Rabbit Polyclonal Anti-HNF1A Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNF1A antibody: synthetic peptide directed towards the N terminal of human HNF1A. Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE

Rabbit Polyclonal Anti-Insulin Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Insulin Antibody: A synthesized peptide derived from human Insulin

Rabbit polyclonal Neuro D (Ser274) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Neuro D around the phosphorylation site of serine 274 (P-L-SP-P-P).
Modifications Phospho-specific

Rabbit monoclonal antibody against HNF 3 Beta(clone EPR4466)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Nkx6.1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A genomic peptide made to an internal region of the human Nkx6.1 protein (within residues 50-200). [Swiss-Prot P78426]

Rabbit anti-NR5A2 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NR5A2

Rabbit Polyclonal Anti-PKLR Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PKLR antibody: synthetic peptide directed towards the N terminal of human PKLR. Synthetic peptide located within the following region: STSIIATIGPASRSVERLKEMIKAGMNIARLNFSHGSHEYHAESIANVRE

Rabbit Polyclonal Anti-SLC2A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC2A2 antibody: synthetic peptide directed towards the N terminal of human SLC2A2. Synthetic peptide located within the following region: ITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVPLDDRKAINNYVINST

Rabbit Monoclonal antibody against NR5A2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-HNF4A Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 241-254 amino acids of human hepatocyte nuclear factor 4, alpha

Rabbit Polyclonal Glut2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human GLUT2 protein (between residues 50-150) [UniProt P11168]

Goat Polyclonal Anti-cardiac troponin T (aa201-213) Antibody

Applications WB
Reactivities Human, Mouse, Pig (Expected from sequence similarity: Feline, Rat, Dog, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-cardiac troponin T (aa201-213) Antibody: Peptide with sequence C-TERKSGKRQTERE, from the internal region of the protein sequence according to NP_000355.2; NP_001001430.1; NP_001001431.1; NP_001001432.1.

Rabbit polyclonal antibody to HNF-1 alpha (HNF1 homeobox A)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 35 and 268 of HNF1 alpha (Uniprot ID#P20823)

Rabbit polyclonal NeuroD1 Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This NeuroD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 15-45 amino acids from the N-terminal region of human NeuroD1.

HNF 4 alpha (HNF4A) (2-15) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Bat, Canine, Equine, Hamster, Human, Monkey, Porcine, Rabbit
Immunogen Synthetic peptide from the N-terminus of human HNF4A / HNF4 (NP_849180.1; NP_000448.3; NP_849181.1)

Insulin (INS) (+Proinsulin) mouse monoclonal antibody, clone D3E7 (5B6/6), Purified

Applications ELISA, IHC
Reactivities Bovine, Human, Mouse, Porcine, Rat

Rabbit Polyclonal NKX2-2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen NKX2-2 antibody was raised against a 19 amino acid synthetic peptide near the center of human NKX2-2.

Rabbit polyclonal HNF4A Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen This HNF4A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 281-312 amino acids from the Central region of human HNF4A.

FOXA2 (453-463) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Bat, Bovine, Canine, Chicken, Equine, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Xenopus
Immunogen Synthetic peptide from C-terminus of human FOXA2

Goat Polyclonal Antibody against HNF4A

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence RLSKTLVDMDMADY-C, from the N Terminus of the protein sequence according to NP_849180.1; NP_000448.3; NP_849181.1.

GLUT2 Goat Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human
Conjugation Unconjugated
Immunogen SLC2A2 / GLUT2 antibody was raised against synthetic peptide C-RKEREEASSEQKVS from an internal region of human SLC2A2 / GLUT2 (NP_000331.1). Percent identity by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Marmoset, Panda, Bat, Rabbit, Horse, Pig (93%); Rat, Sheep, Elephant, Dog, Bovine (86%).

Rabbit polyclonal GCK Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This GCK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human GCK.

Rabbit anti-HNF4A Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide of human HNF4A

Rabbit anti-PDX1 Polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human PDX1

Rabbit Polyclonal Anti-MNX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MNX1 antibody: synthetic peptide directed towards the N terminal of human MNX1. Synthetic peptide located within the following region: AAASGTGGGGGGGGASGGTSGSCSPASSEPPAAPADRLRAESPSPPRLLA

Rabbit Polyclonal Anti-FOXA3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXA3 antibody: synthetic peptide directed towards the middle region of human FOXA3. Synthetic peptide located within the following region: FENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPAATVTSP

Rabbit Polyclonal MNX1/HLXB9 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A portion of amino acids 330-380 of mouse HB9 was used as the immunogen.

Rabbit Polyclonal Anti-HHEX Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HHEX antibody: synthetic peptide directed towards the C terminal of human HHEX. Synthetic peptide located within the following region: DQRQDLPSEQNKGASLDSSQCSPSPASQEDLESEISEDSDQEVDIEGDKS

Rabbit Polyclonal Anti-FOXA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXA2 antibody: synthetic peptide directed towards the N terminal of human FOXA2. Synthetic peptide located within the following region: MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAA

Rabbit Polyclonal Anti-FOXA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXA2 antibody: synthetic peptide directed towards the C terminal of human FOXA2. Synthetic peptide located within the following region: QVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNS

Rabbit Polyclonal Anti-IAPP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IAPP antibody: synthetic peptide directed towards the N terminal of human IAPP. Synthetic peptide located within the following region: MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLV

Rabbit Polyclonal Anti-Neuro D Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Neuro D Antibody: A synthesized peptide derived from human Neuro D

Rabbit Polyclonal Anti-HNF4alpha /gamma Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HNF4alpha /gamma Antibody: A synthesized peptide derived from human HNF4alpha /gamma

Rabbit Polyclonal Anti-HNF-1β(TCF-2) Antibody 

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HNF-1β(TCF-2) Antibody: Peptide sequence around aa.252~256(R-Q-K-N-P) derived from Human HNF-1b(TCF-2).
INS

USD 320.00

In Stock

Goat Polyclonal Anti-INS Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant human Insulin produced in E. coli as a fusion protein.

HES1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide.
Epitope: N-Terminus

PAX6 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen Recombinant protein from human PAX6

Insulin (INS) (+Proinsulin) mouse monoclonal antibody, clone 5E4/3 (D6C4), Purified

Applications ELISA, IHC
Reactivities Bovine, Human, Mouse, Porcine, Rat

Goat Polyclonal Antibody against TCF2 / VHNF1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QAYDRQKNPSKEER, from the internal region of the protein sequence according to NP_000449.1; NP_006472.1.

Goat Polyclonal Antibody against FOXA2

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-GVYSRPIMNSS, from the C Terminus of the protein sequence according to NP_068556.1; NP_710141.1.

Rabbit Polyclonal antibody to Pyruvate Kinase (liver/RBC) (pyruvate kinase, liver and RBC)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 260 of Pyruvate Kinase (liver/RBC) (Uniprot ID#P30613)

Anti-HNF1A Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 57-70 amino acids of human HNF1 homeobox A

Anti-FOXA2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 311-325 amino acids of Human forkhead box A2

Rabbit polyclonal FOXA2 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This FOXA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 128-157 amino acids from the Central region of human FOXA2.

Rabbit polyclonal FOXA2 Antibody (C-term)

Applications IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen This FOXA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 380-407 amino acids from the C-terminal region of human FOXA2.