Primary Antibodies

View as table Download

MMP9 rabbit monoclonal antibody, clone EP1255Y, Supernatant

Applications IF, IHC, WB
Reactivities Guinea Pig, Human

Rabbit polyclonal MITF (Ab-180/73) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human MITF around the phosphorylation site of serine 180/73 (P-N-SP-P-M).

MITF (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 8-36 amino acids from the N-terminal region of Human MITF.

Rabbit polyclonal MITF (Ser180/73) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human MITF around the phosphorylation site of serine 73 (P-N-SP-P-M).
Modifications Phospho-specific

Rabbit Polyclonal MITF (Ser180/73) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human MITF around the phosphorylation site of Serine 180/73
Modifications Phospho-specific

Rabbit Polyclonal MITF Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human MITF

MITF mouse monoclonal antibody, clone C5+D5, Supernatant

Applications IHC
Reactivities Human

Rabbit Polyclonal Anti-MITF Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-MITF antibody: synthetic peptide directed towards the middle region of human MITF. Synthetic peptide located within the following region: MGSKLEDILMDDTLSPVGVTDPLLSSVSPGASKTSSRRSSMSMEETEHTC

MLH1 mouse monoclonal antibody, clone G168-728, Supernatant

Applications IHC
Reactivities Hamster, Human, Mouse, Rat

MSH2 mouse monoclonal antibody, clone G219-1129, Supernatant

Applications IHC
Reactivities Human

EMA (MUC1) mouse monoclonal antibody, clone MRQ-17, Supernatant

Applications IHC
Reactivities Human, Mouse

Mucin 5AC (MUC5AC) mouse monoclonal antibody, clone MRQ-19, Supernatant

Applications IHC
Reactivities Human

Gastric Mucin (MUC6) mouse monoclonal antibody, clone MRQ-20, Supernatant

Applications IHC
Reactivities Human

MITF Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MITF

Rabbit Polyclonal anti-MITF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MITF antibody is: synthetic peptide directed towards the middle region of Human MITF. Synthetic peptide located within the following region: NSNCEKEGFYKFEEQNRAESECPGMNTHSRASCMQMDDVIDDIISLESSY

Rabbit Polyclonal Anti-MITF Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-MITF antibody: synthetic peptide directed towards the N terminal of human MITF. Synthetic peptide located within the following region: THLENPTKYHIQQAQRQQVKQYLSTTLANKHANQVLSLPCPNQPGDHVMP

Mouse Monoclonal MITF Antibody (21D1418)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-MITF Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 173 amino acids of human matrix metallopeptidase 28

Mouse Monoclonal MiTF Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

Microphthalmia Transcription Factor (MITF) Mouse Monoclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

Mitf Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse

MiTF Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human MiTF