Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
Rabbit Polyclonal IRAK-M Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
Rabbit polyclonal DAPK1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This DAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1360-1389 amino acids from the C-terminal region of human DAPK1. |
BLK Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This BLK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human BLK. |
Rabbit Polyclonal Anti-BRD4 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BRD4 antibody: synthetic peptide directed towards the C terminal of human BRD4. Synthetic peptide located within the following region: EIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSS |
Rabbit Polyclonal ZIPK Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ZIP kinase antibody was raised against a peptide corresponding to amino acids near the center of human ZIP kinase. The immunogen is located within amino acids 270 - 320 of ZIPK. |
Rabbit Polyclonal antibody to CaMKII delta (calcium/calmodulin-dependent protein kinase II delta)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 249 and 445 of CaMK2D (Uniprot ID#Q13557) |
Rabbit Polyclonal antibody to CaMK1D (calcium/calmodulin-dependent protein kinase ID)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 385 of CaMK1D (Uniprot ID#Q8IU85) |
Rabbit polyclonal PKC zeta (Thr410) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKC? around the phosphorylation site of threonine 410 (T-S-TP-F-C). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-TRIM33 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM33 antibody: synthetic peptide directed towards the middle region of human TRIM33. Synthetic peptide located within the following region: EIYSDRTFAPLPEFEQEEDDGEVTEDSDEDFIQPRRKRLKSDERPVHIK |
Rabbit polyclonal ETK / BMX(Ab-566) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human ETK around the phosphorylation site of tyrosine 566 (D-Q-YP-V-S). |
Rabbit polyclonal TGFBR2 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This TGFBR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-40 amino acids from the N-terminal region of human TGFBR2. |
Rabbit polyclonal FGFR4 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FGFR4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 24-55 amino acids from the N-terminal region of human FGFR4. |
Rabbit Polyclonal Antibody against BRAF (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This B-RAF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 424-453 amino acids from the Central region of human B-RAF. |
Rabbit polyclonal CSFR (Ab-809) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CSFR around the phosphorylation site of tyrosine 809 (S-N-YP-I-V). |
Rabbit polyclonal TNK2 / ACK1 (Tyr284) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ACK1 around the phosphorylation site of tyrosine 284 (D-H-YP-V-M). |
| Modifications | Phospho-specific |
Rabbit polyclonal p38 MAPK (Ab-322) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human p38 MAPK around the phosphorylation site of tyreonine 322 (D-P-Y-D-Q). |
Rabbit Polyclonal Antibody against DDR1 (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This DDR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 299-330 amino acids from the Central region of human DDR1. |
Rabbit Polyclonal Antibody against AKT2 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This AKT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-123 amino acids from the N-terminal region of human AKT2. |
Rabbit polyclonal antibody to PRKACA (protein kinase, cAMP-dependent, catalytic, alpha)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 351 of PKA C alpha (Uniprot ID#P17612) |
Active filters
Applications
- IF
Antibody Hosts
- Rabbit
Clonalities
- Polyclonal
Families
- Protein Kinase
Filter by
Category
Target Symbol
- RPS6KB1 (13)
- AKT1 (11)
- KDR (7)
- MAPK8 (7)
- PAK1 (6)
- AKT2 (5)
- BMX (5)
- IKBKB (5)
- IRAK2 (5)
- LIMK2 (5)
- MET (5)
- NTRK1 (5)
- PDGFRB (5)
- PTK2 (5)
- RPS6KA1 (5)
- ABL1 (4)
- CSF1R (4)
- ERBB3 (4)
- FLT3 (4)
- MAP3K5 (4)
- PRKCQ (4)
- BRAF (3)
- CAMK1D (3)
- CDK6 (3)
- CHUK (3)
- CSNK1A1 (3)
- DYRK1A (3)
- EGFR (3)
- EPHA2 (3)
- ERBB2 (3)
- ERN1 (3)
- LCK (3)
- MAPK14 (3)
- MAPK15 (3)
- MTOR (3)
- NTRK2 (3)
- PDK4 (3)
- PRKAA1 (3)
- PRKACA (3)
- RIPK2 (3)
- SRC (3)
- ULK2 (3)
- ZAP70 (3)
- AAK1 (2)
- ALK (2)
- ATM (2)
- BRSK1 (2)
- CAMK2A (2)
- CDK2 (2)
- CHEK2 (2)
- CSNK1E (2)
- DYRK3 (2)
- EIF2AK2 (2)
- EPHA1 (2)
- EPHA6 (2)
- EPHB1 (2)
- EPHB6 (2)
- ERBB4 (2)
- FGR (2)
- FLT1 (2)
- GRK6 (2)
- GSK3B (2)
- IGF1R (2)
- IRAK3 (2)
- JAK2 (2)
- MAP2K1 (2)
- MAP2K2 (2)
- MAP2K4 (2)
- MAP3K14 (2)
- MAP3K8 (2)
- MAP4K4 (2)
- MAPK3 (2)
- MARK4 (2)
- PAK2 (2)
- PDGFRA (2)
- PIK3R4 (2)
- PINK1 (2)
- PRKD1 (2)
- PRKDC (2)
- PTK2B (2)
- RAF1 (2)
- RET (2)
- ROCK1 (2)
- SGK1 (2)
- STK11 (2)
- TRIM33 (2)
- TYK2 (2)
- ULK1 (2)
- ACVR1B (1)
- ACVR1C (1)
- ACVRL1 (1)
- ADCK1 (1)
- ARAF (1)
- AURKA (1)
- AURKB (1)
- BCKDK (1)
- BCR (1)
- BLK (1)
- BMPR1B (1)
- BRD4 (1)
Reactivities
Conjugates
Modifications
Pathways
- Pathways in cancer (110)
- MAPK signaling pathway (107)
- ErbB signaling pathway (93)
- Focal adhesion (87)
- Neurotrophin signaling pathway (87)
- Insulin signaling pathway (67)
- Chemokine signaling pathway (65)
- T cell receptor signaling pathway (65)
- Prostate cancer (60)
- Acute myeloid leukemia (57)
- mTOR signaling pathway (56)
- Colorectal cancer (55)
- Pancreatic cancer (55)
- Progesterone-mediated oocyte maturation (52)
- Glioma (51)
- Endocytosis (50)
- Fc gamma R-mediated phagocytosis (50)
- Melanoma (50)
- Regulation of actin cytoskeleton (50)
- Toll-like receptor signaling pathway (50)
- Axon guidance (49)
- Chronic myeloid leukemia (48)
- Adipocytokine signaling pathway (46)
- Apoptosis (46)
- Renal cell carcinoma (43)
- VEGF signaling pathway (43)
- Fc epsilon RI signaling pathway (42)
- Non-small cell lung cancer (41)
- Epithelial cell signaling in Helicobacter pylori infection (40)
- Cytokine-cytokine receptor interaction (38)
- GnRH signaling pathway (38)
- Endometrial cancer (37)
- B cell receptor signaling pathway (36)
- Small cell lung cancer (35)
- Tight junction (30)
- Calcium signaling pathway (28)
- Natural killer cell mediated cytotoxicity (28)
- Wnt signaling pathway (27)
- Adherens junction (26)
- Gap junction (26)
- Long-term potentiation (25)
- Oocyte meiosis (25)
- NOD-like receptor signaling pathway (24)
- Vascular smooth muscle contraction (24)
- Bladder cancer (23)
- TGF-beta signaling pathway (23)
- Cell cycle (22)
- Jak-STAT signaling pathway (22)
- RIG-I-like receptor signaling pathway (22)
- Type II diabetes mellitus (19)
- Melanogenesis (18)
- Thyroid cancer (16)
- Long-term depression (15)
- Leukocyte transendothelial migration (14)
- Hedgehog signaling pathway (13)
- Regulation of autophagy (12)
- p53 signaling pathway (12)
- Cytosolic DNA-sensing pathway (11)
- Hematopoietic cell lineage (9)
- Prion diseases (9)
- Alzheimer's disease (8)
- Amyotrophic lateral sclerosis (ALS) (8)
- Pathogenic Escherichia coli infection (8)
- Primary immunodeficiency (8)
- Dorso-ventral axis formation (7)
- Olfactory transduction (6)
- Hypertrophic cardiomyopathy (HCM) (4)
- Vibrio cholerae infection (4)
- Viral myocarditis (4)
- Dilated cardiomyopathy (3)
- Parkinson's disease (3)
- Taste transduction (3)
- Basal cell carcinoma (2)
- Circadian rhythm - mammal (2)
- Non-homologous end-joining (2)
- PPAR signaling pathway (1)
- Phosphatidylinositol signaling system (1)
- Ubiquitin mediated proteolysis (1)