Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal antibody to CaMK1D (calcium/calmodulin-dependent protein kinase ID)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 385 of CaMK1D (Uniprot ID#Q8IU85) |
Rabbit polyclonal IGF1R (Tyr1346) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IGF1R around the phosphorylation site of tyrosine 1346 (Q-P-YP-A-H). |
| Modifications | Phospho-specific |
Rabbit polyclonal PKC zeta (Thr410) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKC? around the phosphorylation site of threonine 410 (T-S-TP-F-C). |
| Modifications | Phospho-specific |
Rabbit polyclonal CDK5 (Ab-15) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CDK5 around the phosphorylation site of tyrosine 15 (G-T-YP-G-T) |
Rabbit polyclonal MAP2K7 (Ser271) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAP2K7 around the phosphorylation site of serine 271 (V-D-SP-K-A). |
| Modifications | Phospho-specific |
PDGF Receptor alpha (PDGFRA) (1035-1053) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide KLH-conjugated corresponding to amino acids 1000 to the C-term of Human PDGF |
Rabbit polyclonal ETK / BMX(Ab-566) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human ETK around the phosphorylation site of tyrosine 566 (D-Q-YP-V-S). |
Rabbit polyclonal TGFBR2 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This TGFBR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-40 amino acids from the N-terminal region of human TGFBR2. |
Rabbit polyclonal FGFR4 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FGFR4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 24-55 amino acids from the N-terminal region of human FGFR4. |
Rabbit Polyclonal Anti-BMP2K Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BMP2K antibody: synthetic peptide directed towards the C terminal of human BMP2K. Synthetic peptide located within the following region: AQHQPSQQQASPEYLTSPQEFSPALVSYTSSLPAQVGTIMDSSYSANRSV |
Rabbit Polyclonal Anti-DMPK Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DMPK antibody: synthetic peptide directed towards the middle region of human DMPK. Synthetic peptide located within the following region: TRLGRGGAGDFRTHPFFFGLDWDGLRDSVPPFTPDFEGATDTCNFDLVED |
Rabbit anti-MTOR polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized non-phosphopeptide derived fromhuman mTOR around the phosphorylation site of serine 2448 (T-D-SP-Y-S). |
Rabbit polyclonal CSFR (Ab-809) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CSFR around the phosphorylation site of tyrosine 809 (S-N-YP-I-V). |
Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C). |
| Modifications | Phospho-specific |
Rabbit polyclonal TNK2 / ACK1 (Tyr284) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ACK1 around the phosphorylation site of tyrosine 284 (D-H-YP-V-M). |
| Modifications | Phospho-specific |
Rabbit polyclonal p38 MAPK (Ab-322) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human p38 MAPK around the phosphorylation site of tyreonine 322 (D-P-Y-D-Q). |
Rabbit anti-PDGFRB Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PDGFRB |
Rabbit Polyclonal anti-PIM-1 Antibody
| Applications | IHC |
| Reactivities | Human |
| Immunogen | Synthetic peptide derived from internal region of human PIM1 protein. |
Rabbit Polyclonal antibody to FAST (Fas-activated serine/threonine kinase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 346 and 549 of FAST (Uniprot ID#Q14296) |
Rabbit polyclonal COT (Ab-290) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human COT around the phosphorylation site of threonine 290 (R-G-TP-E-I). |
Rabbit polyclonal Ret (Ab-905) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Ret around the phosphorylation site of tyrosine 905 (D-S-YP-V-K). |
Rabbit polyclonal anti-MAP3K4 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human MAP3K4. |
Active filters
Category
- Antibodies
Applications
- IHC
Antibody Hosts
- Rabbit
Isotypes
- IgG
Clonalities
- Polyclonal
Families
- Protein Kinase
Filter by
Target Symbol
- AKT1 (22)
- BRAF (8)
- EGFR (8)
- PAK1 (8)
- ALK (6)
- CHUK (6)
- EIF2AK2 (6)
- FGFR2 (6)
- FGFR3 (6)
- GSK3B (6)
- KDR (6)
- LIMK2 (6)
- MAP2K6 (6)
- MAPK14 (6)
- PRKCA (6)
- PRKCQ (6)
- ROCK2 (6)
- SGK1 (6)
- SRC (6)
- SYK (6)
- TNK2 (6)
- CDK6 (5)
- CDK7 (5)
- CSF1R (5)
- ERBB3 (5)
- GSK3A (5)
- JAK1 (5)
- JAK2 (5)
- MERTK (5)
- NTRK1 (5)
- PRKCD (5)
- PTK2B (5)
- RAF1 (5)
- RPS6KB1 (5)
- BMX (4)
- CAMK1D (4)
- CDK1 (4)
- CDK5 (4)
- EIF2AK3 (4)
- ERBB2 (4)
- GRK5 (4)
- IKBKB (4)
- ILK (4)
- IRAK1 (4)
- MAP3K7 (4)
- MAPK1 (4)
- MAPKAPK2 (4)
- NTRK2 (4)
- PAK2 (4)
- PDPK1 (4)
- PRKAA2 (4)
- RPS6KA1 (4)
- STK39 (4)
- STRADB (4)
- TRIB3 (4)
- ZAP70 (4)
- AATK (3)
- ABL1 (3)
- ACVR1B (3)
- ACVR1C (3)
- AKT2 (3)
- AKT3 (3)
- CAMK2A (3)
- CAMK2B (3)
- CAMK4 (3)
- CHEK2 (3)
- CSNK1A1 (3)
- CSNK2A1 (3)
- FGFR1 (3)
- FGR (3)
- FLT3 (3)
- FYN (3)
- GRK1 (3)
- IGF1R (3)
- IKBKE (3)
- LATS1 (3)
- LIMK1 (3)
- MAP2K2 (3)
- MAP2K4 (3)
- MAP3K4 (3)
- MAP3K5 (3)
- MAP3K8 (3)
- MAP4K5 (3)
- MAPK15 (3)
- MAPK8 (3)
- MET (3)
- MTOR (3)
- PAK5 (3)
- PDGFRB (3)
- PDK2 (3)
- PIK3R4 (3)
- PLK1 (3)
- PRKD1 (3)
- PRKD2 (3)
- PRKD3 (3)
- ROCK1 (3)
- SIK1 (3)
- SRPK1 (3)
- STK11 (3)
- STK26 (3)
Reactivities
Conjugates
Modifications
Pathways
- MAPK signaling pathway (223)
- Pathways in cancer (180)
- Focal adhesion (150)
- ErbB signaling pathway (144)
- Chemokine signaling pathway (136)
- Neurotrophin signaling pathway (135)
- T cell receptor signaling pathway (121)
- Prostate cancer (107)
- Insulin signaling pathway (102)
- Pancreatic cancer (102)
- Progesterone-mediated oocyte maturation (98)
- Fc epsilon RI signaling pathway (97)
- Regulation of actin cytoskeleton (96)
- Colorectal cancer (93)
- Glioma (93)
- GnRH signaling pathway (93)
- Toll-like receptor signaling pathway (93)
- Endocytosis (90)
- Fc gamma R-mediated phagocytosis (89)
- Chronic myeloid leukemia (87)
- Non-small cell lung cancer (85)
- Melanoma (82)
- Acute myeloid leukemia (81)
- VEGF signaling pathway (80)
- Endometrial cancer (79)
- Axon guidance (78)
- mTOR signaling pathway (78)
- Renal cell carcinoma (77)
- B cell receptor signaling pathway (71)
- Adipocytokine signaling pathway (69)
- Vascular smooth muscle contraction (66)
- Tight junction (64)
- Apoptosis (63)
- Gap junction (61)
- Natural killer cell mediated cytotoxicity (61)
- Adherens junction (60)
- Wnt signaling pathway (59)
- Long-term potentiation (58)
- Calcium signaling pathway (57)
- Epithelial cell signaling in Helicobacter pylori infection (57)
- Oocyte meiosis (52)
- Bladder cancer (51)
- Cytokine-cytokine receptor interaction (51)
- Small cell lung cancer (49)
- Cell cycle (46)
- Melanogenesis (45)
- TGF-beta signaling pathway (42)
- Jak-STAT signaling pathway (40)
- Long-term depression (39)
- NOD-like receptor signaling pathway (37)
- RIG-I-like receptor signaling pathway (36)
- Leukocyte transendothelial migration (34)
- Type II diabetes mellitus (28)
- Thyroid cancer (25)
- Hedgehog signaling pathway (22)
- Pathogenic Escherichia coli infection (21)
- Prion diseases (21)
- p53 signaling pathway (21)
- Alzheimer's disease (20)
- Amyotrophic lateral sclerosis (ALS) (19)
- Cytosolic DNA-sensing pathway (16)
- Dorso-ventral axis formation (16)
- Olfactory transduction (16)
- Vibrio cholerae infection (15)
- Regulation of autophagy (14)
- Hematopoietic cell lineage (10)
- Basal cell carcinoma (8)
- PPAR signaling pathway (8)
- Phosphatidylinositol signaling system (8)
- Primary immunodeficiency (8)
- Dilated cardiomyopathy (7)
- Taste transduction (7)
- Viral myocarditis (7)
- Hypertrophic cardiomyopathy (HCM) (6)
- Nucleotide excision repair (5)
- Circadian rhythm - mammal (3)
- Purine metabolism (3)
- Basal transcription factors (2)
- Parkinson's disease (2)
- Ubiquitin mediated proteolysis (2)
- Non-homologous end-joining (1)