Rabbit Polyclonal ASAH1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ASAH1 antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of the human ASAH1. The immunogen is located within amino acids 240 - 290 of ASAH1. |
Rabbit Polyclonal Anti-NEU1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NEU1 antibody: synthetic peptide directed towards the middle region of human NEU1. Synthetic peptide located within the following region: VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG |
Rabbit polyclonal GC Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This GC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 337-365 amino acids from the Central region of human GC. |
Rabbit Polyclonal Anti-PPAP2A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the middle region of human PPAP2A. Synthetic peptide located within the following region: DPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVAL |
Rabbit polyclonal NEU2 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NEU2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 23-50 amino acids from the N-terminal region of human NEU2. |
Rabbit anti-GLB1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GLB1 |
Rabbit polyclonal antibody to beta-glucosidase (glucosidase, beta; acid (includes glucosylceramidase))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 65 and 384 of GBA (Uniprot ID#P04062) |
Rabbit polyclonal SPHK1 Antibody (Center)
| Applications | IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This SPHK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 286-315 amino acids from the Central region of human SPHK1. |
DEGS1 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide derived from the Human DEGS1 protein |
Rabbit Polyclonal SPT1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | SPT1 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human SPT1. The immunogen is located within amino acids 380 - 430 of SPT1. |
Rabbit Polyclonal anti-PPAP2A antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the N terminal of human PPAP2A. Synthetic peptide located within the following region: QIYPFQRGFFCKDNSINYPYHDSTVTSTVLILVGVGLPISSIILGETLSV |
Rabbit Polyclonal Anti-SGPP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SGPP2 antibody: synthetic peptide directed towards the C terminal of human SGPP2. Synthetic peptide located within the following region: SKPAESLPVIQNIPPLTTYMLVLGLTKFAVGIVLILLVRQLVQNLSLQVL |
Rabbit Polyclonal Anti-DEGS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DEGS1 antibody: synthetic peptide directed towards the N terminal of human DEGS1. Synthetic peptide located within the following region: GSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMV |
Rabbit Polyclonal Anti-SPTLC1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SPTLC1 antibody: synthetic peptide directed towards the middle region of human SPTLC1. Synthetic peptide located within the following region: ICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGINIDDIDLI |
Rabbit polyclonal SPHK2(Thr614) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human SPHK2 around the phosphorylation site of threonine 614 (P-L-TP-P-R). |
| Modifications | Phospho-specific |
Anti-PPAP2A Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 40-53 amino acids of human phosphatidic acid phosphatase type 2A |
Rabbit Polyclonal Anti-SPTLC1 Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SPTLC1 |
Rabbit Polyclonal Anti-ASAH1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ASAH1 |
Rabbit Polyclonal Anti-DEGS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DEGS1 |
Rabbit Polyclonal Anti-GALC Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GALC |
Germany
Japan
United Kingdom
China
