Antibodies

View as table Download

Rabbit Polyclonal Anti-GADD45B Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GADD45B antibody: synthetic peptide directed towards the middle region of human GADD45B. Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW

Rabbit Polyclonal Bax Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Monoclonal Antibody against CASP3 (Clone E87)

Applications FC, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Rabbit anti-CDK4 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Center-peptide of human CDK4

Rabbit Polyclonal CDKN2A Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CDKN2A antibody was raised against a 18 amino acid peptide from near the amino terminus of human CDKN2A.

Rabbit Polyclonal antibody to PIG3 (tumor protein p53 inducible protein 3)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 332 of PIG3 (Uniprot ID#Q53FA7)

Rabbit anti-CYCS Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CYCS

Rabbit polyclonal Caspase 9 (Cleaved-Asp315) antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Caspase 9.

CASP3 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human CASP3

Rabbit monoclonal antibody against PTEN Phospho (Ser380) (clone EPR2062Y ) (Phospho-Specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Phospho-specific

Rabbit polyclonal anti-Cyclin E1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Cyclin E1.

Rabbit Polyclonal Anti-KIRREL2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen KIRREL2 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human KIRREL2.

Rabbit anti-CDK1 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Center-peptide of human CDK1

Rabbit anti-SFN Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SFN

Rabbit anti-GADD45A Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GADD45A

Bax Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human Bax

Rabbit polyclonal APAF-1-ALT antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human APAF-1-ALT.

Rabbit polyclonal p16-INK4a (Phospho-Ser152) antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human p16-INK4a around the phosphorylation site of serine 152 (G-P-SP-D-I).
Modifications Phospho-specific

Rabbit anti-SIAH1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SIAH1

Phospho-CDK1-T161 Rabbit Polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding T161 of human CDK1
Modifications Phospho-specific

Rabbit polyclonal Caspase 3 (Cleaved-Asp175) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Caspase 3.

CCND1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CCND1

Phospho-CDK2-T160 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding T160 of human CDK2
Modifications Phospho-specific

Rabbit Polyclonal Anti-SERPINB5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SERPINB5 antibody: synthetic peptide directed towards the middle region of human SERPINB5. Synthetic peptide located within the following region: NSVNDQTKILVVNAAYFVGKWMKKFPESETKECPFRLNKTDTKPVQMMNM

Rabbit Monoclonal Antibody against CASP3 (Clone E83-103)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit polyclonal CASP8 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CASP8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 432-461 amino acids from the C-terminal region of human CASP8.

Rabbit Polyclonal p53R2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen p53R2 antibody was raised against a synthetic peptide corresponding to amino acids 2 to 17 of human p53R2 .

Rabbit Polyclonal KAI1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen KAI1 antibody was raised against a 15 amino acid peptide from near the carboxy terminus of human KAI1.

Rabbit polyclonal CDK4 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CDK4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 273-305 amino acids from the C-terminal region of human CDK4.

Anti-Human IGF-I Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IGF-I

Phospho-CDK6-Y13 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding Y13 of human CDK6
Modifications Phospho-specific

Rabbit Polyclonal Antibody against MDM2 (C-term)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This Mdm2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 393-424 amino acids from the C-terminal region of human Mdm2.

Rabbit Polyclonal DR5 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen DR5 antibody was raised against a peptide corresponding to 20 amino acids near the carboxy terminus of human DR5 precursor. The immunogen is located within the last 50 amino acids of DR5.

Rabbit polyclonal Cyclin E1 (Ab-395) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Cyclin E1 around the phosphorylation site of threonine 395 (L-L-T-P-P).

Rabbit polyclonal anti-MDM2 antibody

Applications IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human MDM2.

Rabbit polyclonal anti-BAX antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human BAX.

Rabbit polyclonal Cyclin B1 (Ab-126) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Cyclin B1 around the phosphorylation site of serine 126 (T-A-S-P-S).

Rabbit polyclonal anti-BAI1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human BAI1.

Rabbit polyclonal Cyclin D3 (Thr283) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Cyclin D3 around the phosphorylation site of threonine 283 (T-S-TP-P-T).
Modifications Phospho-specific

Rabbit polyclonal p14 ARF antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human p14 ARF antibody.

Rabbit anti-TP53 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TP53

Rabbit anti-IGF1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human IGF1

Rabbit Polyclonal 14-3-3 sigma/Stratifin Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Rabbit Polyclonal PIG3 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal Cyclin B1 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal MASPIN Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit Polyclonal PUMA Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen PUMA antibody was raised against a synthetic peptide corresponding to 14 amino acids near the amino terminus of human PUMA-a This sequence is identical between a and b ?forms of the PUMA proteins.

Rabbit polyclonal Cyclin D3 (Ab-283) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Cyclin D3 around the phosphorylation site of threonine 283 (T-S-TP-P-T).

Rabbit polyclonal Cyclin E1 (Thr395) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Cyclin E1 around the phosphorylation site of threonine 395 (L-L-TP-P-P).
Modifications Phospho-specific

Rabbit polyclonal Chk1 (Ser296) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Chk1 around the phosphorylation site of serine 296 (I-Q-SP-N-L).
Modifications Phospho-specific