Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-Abca7 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Abca7 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLL |
Phospho-IGF1R-Y1161 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y1161 of human IGF1R |
| Modifications | Phospho-specific |
Phospho-KDR-Y1175 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y1175 of human KDR |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CHRM1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CHRM1 |
Rabbit polyclonal anti-COX IV antibody, Loading control
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Bovine, Primate, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human COX4-1 protein (within residues 1-100). [Swiss-Prot# P13073] |
Rabbit Polyclonal Disp2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Disp2 antibody was raised against a 19 amino acid peptide from near the carboxy terminus of human Disp2. |
Rabbit Polyclonal CLDN1 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CLDN1 antibody was raised against a 20 amino acid synthetic peptide near the carboxy terminus of human CLDN1. The immunogen is located within the last 50 amino acids of CLDN1. |
Rabbit polyclonal antibody to BMPR2 (bone morphogenetic protein receptor, type II (serine/threonine kinase))
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 667 and 951 of BMPR2 (Uniprot ID#Q13873) |
Rabbit Polyclonal antibody to RANKL (tumor necrosis factor (ligand) superfamily, member 11)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 253 and 317 of RANKL (Uniprot ID#O14788) |
Rabbit polyclonal Ret (Ab-905) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Ret around the phosphorylation site of tyrosine 905 (D-S-YP-V-K). |
Rabbit polyclonal EPHA4 (Tyr596) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EPHA4 around the phosphorylation site of tyrosine 596. |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-NOX1 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human NOX1. |
Rabbit polyclonal ANKH Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ANKH antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 464-492 amino acids from the C-terminal region of human ANKH. |
Rabbit anti-IL27 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL27 |
Rabbit Polyclonal Anti-AGPAT6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human AGPAT6 |
Rabbit Polyclonal DR5 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | DR5 antibody was raised against a peptide corresponding to 20 amino acids near the carboxy terminus of human DR5 precursor. The immunogen is located within the last 50 amino acids of DR5. |
Rabbit Polyclonal antibody to UGT1A9 (UDP glucuronosyltransferase 1 family, polypeptide A9)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 291 and 530 of UGT1A9 (Uniprot ID#O60656) |
Rabbit Polyclonal antibody to RAMP2 (receptor (G protein-coupled) activity modifying protein 2)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 111 and 175 of RAMP2 (Uniprot ID#O60895) |
Rabbit polyclonal IL-8R beta/CDw128 beta (Ser347) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IL-8R beta/CDw128 beta around the phosphorylation site of serine 347 (R-P-SP-F-V). |
| Modifications | Phospho-specific |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Mouse
Applications
- WB
Antibody Hosts
- Rabbit
Isotypes
- IgG
Families
- Transmembrane
Availabilities
- In Stock
Filter by
Target Symbol
- EGFR (17)
- GRIN2B (9)
- MET (9)
- FGFR1 (8)
- ERBB2 (7)
- BCL2L1 (6)
- CSF1R (6)
- IGF1R (6)
- APP (5)
- EPHA2 (5)
- NGFR (5)
- PDGFRB (5)
- STX1A (5)
- SYT1 (5)
- CD44 (4)
- CLDN1 (4)
- CLDN7 (4)
- GLRA1 (4)
- NOTCH2 (4)
- ABCD4 (3)
- ACE (3)
- CA14 (3)
- CASR (3)
- CD19 (3)
- CFTR (3)
- CSF2RA (3)
- EDNRA (3)
- EPHA3 (3)
- F10 (3)
- GJA1 (3)
- GRIK1 (3)
- GRM3 (3)
- HAVCR1 (3)
- INSR (3)
- ITGB3 (3)
- KCNA5 (3)
- KDR (3)
- KIT (3)
- LPAR4 (3)
- MUC1 (3)
- NTRK2 (3)
- PTGER2 (3)
- SPAG4 (3)
- ABCB6 (2)
- ACVR2A (2)
- ADAM17 (2)
- ADRA1A (2)
- AIFM1 (2)
- ALCAM (2)
- ALDH6A1 (2)
- ANO1 (2)
- ANTXR1 (2)
- APLNR (2)
- APLP1 (2)
- APLP2 (2)
- AQP1 (2)
- ARMCX2 (2)
- ARMCX3 (2)
- ATP2A1 (2)
- AUP1 (2)
- BACE1 (2)
- BAX (2)
- BCL2 (2)
- BNIP1 (2)
- CA4 (2)
- CADM4 (2)
- CAV1 (2)
- CCR3 (2)
- CDH3 (2)
- CERS2 (2)
- CLDN11 (2)
- COX4I1 (2)
- CRHR2 (2)
- CUX1 (2)
- CX3CR1 (2)
- CYB5A (2)
- CYP3A4 (2)
- DIABLO (2)
- EDA (2)
- EFNB1 (2)
- EFNB3 (2)
- EPHA4 (2)
- EPHB1 (2)
- FLT3 (2)
- FZD4 (2)
- GABRB1 (2)
- GHSR (2)
- GPAT3 (2)
- GPAT4 (2)
- GPR15 (2)
- GRIN1 (2)
- GRM5 (2)
- GRM7 (2)
- GRM8 (2)
- GRPR (2)
- IGF2R (2)
- IL11RA (2)
- IL2RB (2)
- ITGA4 (2)
- ITGB1 (2)
Clonalities
Conjugates
Modifications
Pathways
- Cytokine-cytokine receptor interaction (113)
- Neuroactive ligand-receptor interaction (113)
- Pathways in cancer (105)
- Calcium signaling pathway (71)
- Focal adhesion (68)
- Endocytosis (63)
- Adherens junction (56)
- Colorectal cancer (54)
- Regulation of actin cytoskeleton (53)
- Metabolic pathways (50)
- Prostate cancer (49)
- Melanoma (48)
- MAPK signaling pathway (43)
- Hematopoietic cell lineage (42)
- Cell adhesion molecules (CAMs) (40)
- Alzheimer's disease (38)
- Axon guidance (36)
- Pancreatic cancer (34)
- Gap junction (33)
- Glioma (31)
- Epithelial cell signaling in Helicobacter pylori infection (30)
- ErbB signaling pathway (29)
- Bladder cancer (26)
- Huntington's disease (26)
- Leukocyte transendothelial migration (26)
- Endometrial cancer (25)
- Non-small cell lung cancer (25)
- Amyotrophic lateral sclerosis (ALS) (24)
- Jak-STAT signaling pathway (22)
- Dorso-ventral axis formation (21)
- ABC transporters (20)
- GnRH signaling pathway (20)
- Melanogenesis (20)
- ECM-receptor interaction (18)
- Hypertrophic cardiomyopathy (HCM) (18)
- Tight junction (17)
- Apoptosis (16)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (16)
- Dilated cardiomyopathy (16)
- SNARE interactions in vesicular transport (16)
- Wnt signaling pathway (16)
- Long-term potentiation (15)
- Neurotrophin signaling pathway (15)
- Vascular smooth muscle contraction (15)
- Small cell lung cancer (13)
- Basal cell carcinoma (12)
- Renal cell carcinoma (12)
- Systemic lupus erythematosus (12)
- Chemokine signaling pathway (11)
- Notch signaling pathway (10)
- Parkinson's disease (10)
- Chronic myeloid leukemia (9)
- Long-term depression (9)
- Natural killer cell mediated cytotoxicity (9)
- Oxidative phosphorylation (9)
- Primary immunodeficiency (9)
- Retinol metabolism (9)
- TGF-beta signaling pathway (9)
- Lysosome (7)
- Oocyte meiosis (7)
- Pathogenic Escherichia coli infection (7)
- Progesterone-mediated oocyte maturation (7)
- Renin-angiotensin system (7)
- Vibrio cholerae infection (7)
- Acute myeloid leukemia (6)
- Arachidonic acid metabolism (6)
- Cardiac muscle contraction (6)
- Toll-like receptor signaling pathway (6)
- Viral myocarditis (6)
- p53 signaling pathway (6)
- Complement and coagulation cascades (5)
- Fc gamma R-mediated phagocytosis (5)
- Glycerolipid metabolism (5)
- Glycerophospholipid metabolism (5)
- Insulin signaling pathway (5)
- Metabolism of xenobiotics by cytochrome P450 (5)
- Nitrogen metabolism (5)
- Adipocytokine signaling pathway (4)
- B cell receptor signaling pathway (4)
- Drug metabolism - cytochrome P450 (4)
- Hedgehog signaling pathway (4)
- N-Glycan biosynthesis (4)
- Prion diseases (4)
- T cell receptor signaling pathway (4)
- Androgen and estrogen metabolism (3)
- Antigen processing and presentation (3)
- Biosynthesis of unsaturated fatty acids (3)
- Drug metabolism - other enzymes (3)
- Ether lipid metabolism (3)
- Glycosphingolipid biosynthesis - ganglio series (3)
- Inositol phosphate metabolism (3)
- Linoleic acid metabolism (3)
- PPAR signaling pathway (3)
- Primary bile acid biosynthesis (3)
- Purine metabolism (3)
- Riboflavin metabolism (3)
- Sphingolipid metabolism (3)
- Thyroid cancer (3)
- Type II diabetes mellitus (3)
- VEGF signaling pathway (3)
- Asthma (2)
- Cell cycle (2)
- Fatty acid metabolism (2)
- Fc epsilon RI signaling pathway (2)
- Glutathione metabolism (2)
- Olfactory transduction (2)
- Phosphatidylinositol signaling system (2)
- Porphyrin and chlorophyll metabolism (2)
- Propanoate metabolism (2)
- Pyrimidine metabolism (2)
- Steroid biosynthesis (2)
- Taste transduction (2)
- Tryptophan metabolism (2)
- Tyrosine metabolism (2)
- Valine (2)
- leucine and isoleucine degradation (2)
- Allograft rejection (1)
- Amino sugar and nucleotide sugar metabolism (1)
- Ascorbate and aldarate metabolism (1)
- Autoimmune thyroid disease (1)
- C21-Steroid hormone metabolism (1)
- Cyanoamino acid metabolism (1)
- Cytosolic DNA-sensing pathway (1)
- Glycosphingolipid biosynthesis - lacto and neolacto series (1)
- Graft-versus-host disease (1)
- Heparan sulfate biosynthesis (1)
- Keratan sulfate biosynthesis (1)
- Nicotinate and nicotinamide metabolism (1)
- O-Glycan biosynthesis (1)
- O-Mannosyl glycan biosynthesis (1)
- Pentose and glucuronate interconversions (1)
- RIG-I-like receptor signaling pathway (1)
- Selenoamino acid metabolism (1)
- Starch and sucrose metabolism (1)
- Taurine and hypotaurine metabolism (1)
- Terpenoid backbone biosynthesis (1)
- Ubiquitin mediated proteolysis (1)