Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal PI3-kinase p85- alpha (Tyr607) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PI3-kinase p85- alpha around the phosphorylation site of Tyrosine 607 |
| Modifications | Phospho-specific |
Rabbit Polyclonal ROCK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ROCK1 |
Rabbit anti-ITGB2 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ITGB2 |
Rabbit Polyclonal Anti-M1 Muscarinic Receptor (443-458)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)RKIPKRPGSVHRTPSR, corresponding to amino acid residues 443-458 of human M1 Muscarinic Receptor. Intracellular, C-terminus. |
Rabbit Polyclonal Anti-RAC1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAC1 antibody: synthetic peptide directed towards the middle region of human RAC1. Synthetic peptide located within the following region: LAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL |
Rabbit Polyclonal Anti-MYH9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYH9 antibody: synthetic peptide directed towards the middle region of human MYH9. Synthetic peptide located within the following region: DAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAK |
PDGF beta (PDGFB) (PDGF-BB) rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) Recombinant Human PDGF-B. |
Rabbit Polyclonal Antibody against BRAF (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This B-RAF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 424-453 amino acids from the Central region of human B-RAF. |
Rabbit monoclonal antibody against PIP5K1C(clone MAO-R1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal ITGB4 (Ab-1510) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human ITGB4 around the phosphorylation site of tyrosine 1510 (R-D-YP-S-T). |
Rabbit polyclonal SOS2 Antibody (N-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SOS2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 188-215 amino acids from the N-terminal region of human SOS2. |
Rabbit polyclonal anti-Vinculin antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human VCL |
Rabbit anti-PDGFRB Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PDGFRB |
Rabbit anti-CHRM5 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CHRM5 |
Rabbit Polyclonal Integrin alpha M/CD11b Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region (within residues 250-350) of the mouse CD11b protein. [Swiss-Prot# P05555] |
Rabbit Polyclonal Anti-PPP1CA Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP1CA antibody: synthetic peptide directed towards the N terminal of human PPP1CA. Synthetic peptide located within the following region: MSDSEKLNLDSIIGRLLEGSRVLTPHCAPVQGSRPGKNVQLTENEIRGLC |
Rabbit Polyclonal Anti-ACTN4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN4 antibody: synthetic peptide directed towards the C terminal of human ACTN4. Synthetic peptide located within the following region: DVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVI |
Rabbit Polyclonal Anti-CHRM1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CHRM1 |
PDGF AA (PDGFA) (PDGF-AA) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Immunogen | Highly pure (>98%) E.coli derived recombinant Human PDGF-AA (Cat.-No PA118). |
PDGF beta (PDGFB) (PDGF-BB) rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) Recombinant Human PDGF-B. |
USD 524.00
In Stock
Rabbit Polyclonal Antibody against PIK3R1 (N-term L11)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human PI3KR1. |
Rabbit Polyclonal antibody to ARPC2 (actin related protein 2/3 complex, subunit 2, 34kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 14 and 300 of ARPC2 (Uniprot ID#O15144) |
Rabbit Polyclonal antibody to PP1C gamma (protein phosphatase 1, catalytic subunit, gamma isozyme)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 2 and 227 of PP1C gamma (Uniprot ID#P36873) |
Rabbit polyclonal NRAS Antibody (N-term)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NRAS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-101 amino acids from the N-terminal region of human NRAS. |
Rabbit anti-CDC42 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CDC42 |
Rabbit anti-CHRM1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CHRM1 |
ITGAV Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human ITGAV |
Rabbit anti-PPP1CA Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PPP1CA |
Rabbit anti-ITGAL Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Protein of human ITGAL |
Rabbit anti-LIMK2 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LIMK2 |
Rabbit anti-ROCK2 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ROCK2 |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ACTB |
Rabbit Polyclonal Anti-IQGAP3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human IQGAP3 |
Rabbit Polyclonal Anti-MYLK2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MYLK2 |
Integrin alpha 3 (ITGA3) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 500-550 of Human Integrin α3 |
Active filters
Category
- Antibodies
Applications
- WB
Antibody Hosts
- Rabbit
Pathways
- Regulation of actin cytoskeleton
Filter by
Target Symbol
- EGFR (53)
- RAF1 (23)
- PXN (22)
- EZR (21)
- MAP2K1 (21)
- PTK2 (19)
- ACTB (18)
- BRAF (16)
- PAK1 (16)
- PDGFRB (16)
- FGFR1 (15)
- ROCK2 (14)
- CFL1 (13)
- MAPK3 (13)
- EGF (12)
- MAPK1 (12)
- FGF4 (11)
- ITGB3 (11)
- NCF1 (11)
- PDGFB (11)
- PIK3R1 (11)
- SHC1 (11)
- LIMK1 (10)
- LIMK2 (10)
- VCL (10)
- VAV1 (9)
- ACTN2 (8)
- F2R (8)
- ITGA4 (8)
- PDGFRA (8)
- ACTG1 (7)
- BCAR1 (7)
- FGF2 (7)
- ITGAV (7)
- MAP2K2 (7)
- MSN (7)
- NRAS (7)
- PAK2 (7)
- PDGFA (7)
- RHOA (7)
- ACTN1 (6)
- APC (6)
- CHRM1 (6)
- CSK (6)
- ITGB1 (6)
- ITGB4 (6)
- PAK4 (6)
- PFN1 (6)
- PPP1CB (6)
- SLC9A1 (6)
- ACTN3 (5)
- ACTN4 (5)
- F2 (5)
- ITGA5 (5)
- ITGA6 (5)
- ITGB2 (5)
- ITGB5 (5)
- PAK3 (5)
- PAK5 (5)
- PPP1CA (5)
- RAC1 (5)
- ARPC1A (4)
- ARPC3 (4)
- BDKRB1 (4)
- BDKRB2 (4)
- CDC42 (4)
- CHRM5 (4)
- CRK (4)
- CRKL (4)
- FGF1 (4)
- FGF18 (4)
- FGF8 (4)
- GNA13 (4)
- HRAS (4)
- MYL2 (4)
- MYL9 (4)
- PDGFC (4)
- PIK3CA (4)
- PIK3CD (4)
- PIK3R3 (4)
- PPP1CC (4)
- PPP1R12A (4)
- RDX (4)
- ROCK1 (4)
- RRAS2 (4)
- WAS (4)
- APC2 (3)
- ARAF (3)
- ARHGEF7 (3)
- ARPC1B (3)
- ARPC2 (3)
- CFL2 (3)
- CHRM2 (3)
- DIAPH1 (3)
- DOCK1 (3)
- FGF10 (3)
- FGF13 (3)
- FGF22 (3)
- FGF7 (3)
- FGFR2 (3)
Reactivities
- Human (703)
- Mouse (529)
- Rat (451)
- Bovine (30)
- Chicken (28)
- Pig (10)
- Rhesus Monkey (10)
- Xenopus (9)
- Canis (8)
- Monkey (8)
- Rabbit (7)
- Dog (6)
- Drosophila (6)
- X. tropicalis (4)
- Hamster (3)
- Zebrafish (3)
- Chimpanzee (2)
- All Species (1)
- Avian (1)
- C. elegans (1)
- Canine (1)
- Guinea Pig (1)
- Orang-Utan (1)
- Porcine (1)
- Sheep (1)
Clonalities
Conjugates
Modifications
Families
- Druggable Genome (795)
- Protein Kinase (307)
- Transmembrane (239)
- ES Cell Differentiation/IPS (215)
- Secreted Protein (129)
- Adult stem cells (90)
- Cancer stem cells (53)
- Stem cell relevant signaling - JAK/STAT signaling pathway (53)
- Stem cell - Pluripotency (52)
- Embryonic stem cells (37)
- GPCR (29)
- Induced pluripotent stem cells (27)
- Phosphatase (17)
- Transcription Factors (16)
- Stem cell relevant signaling - Wnt Signaling pathway (11)
- Protease (5)