Rabbit Polyclonal PAK1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PAK1 |
Rabbit Polyclonal PAK1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PAK1 |
Rabbit Polyclonal PI3-kinase p85- alpha (Tyr607) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PI3-kinase p85- alpha around the phosphorylation site of Tyrosine 607 |
Modifications | Phospho-specific |
Rabbit Polyclonal ROCK1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human ROCK1 |
Rabbit Polyclonal Vinculin Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Vinculin antibody was raised against a 16 amino acid peptide near the carboxy terminus of human Vinculin. |
Rabbit anti-MEK1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | C term -peptide of human MEK1 |
Rabbit anti-ITGB2 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ITGB2 |
Rabbit anti-BAIAP2 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BAIAP2 |
Anti-Human EGF Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived recombinant Human EGF |
Rabbit Polyclonal Anti-M1 Muscarinic Receptor (443-458)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)RKIPKRPGSVHRTPSR, corresponding to amino acid residues 443-458 of human M1 Muscarinic Receptor. Intracellular, C-terminus. |
Rabbit Polyclonal Anti-RAC1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RAC1 antibody: synthetic peptide directed towards the middle region of human RAC1. Synthetic peptide located within the following region: LAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL |
Rabbit Polyclonal Anti-MYH9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MYH9 antibody: synthetic peptide directed towards the middle region of human MYH9. Synthetic peptide located within the following region: DAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAK |
Myosin Light Chain 2 (MYL2) rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Peptide sequence around amino acids 17~21 (A-T-S-N-V) derived from Human Myosin Light Chain 2 Protein. |
PDGF beta (PDGFB) (PDGF-BB) rabbit polyclonal antibody, Biotin
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Biotin |
Immunogen | Highly pure (>98%) Recombinant Human PDGF-B. |
Rabbit Polyclonal Antibody against BRAF (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This B-RAF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 424-453 amino acids from the Central region of human B-RAF. |
Rabbit monoclonal antibody against PIP5K1C(clone MAO-R1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal ITGB4 (Ab-1510) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human ITGB4 around the phosphorylation site of tyrosine 1510 (R-D-YP-S-T). |
Rabbit polyclonal SOS2 Antibody (N-term)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This SOS2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 188-215 amino acids from the N-terminal region of human SOS2. |
Rabbit polyclonal anti-Vinculin antibody, Loading control
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human VCL |
Rabbit anti-PDGFRB Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PDGFRB |
Rabbit anti-CHRM5 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CHRM5 |
Rabbit Polyclonal Integrin alpha M/CD11b Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region (within residues 250-350) of the mouse CD11b protein. [Swiss-Prot# P05555] |
Rabbit Polyclonal Anti-PPP1CA Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPP1CA antibody: synthetic peptide directed towards the N terminal of human PPP1CA. Synthetic peptide located within the following region: MSDSEKLNLDSIIGRLLEGSRVLTPHCAPVQGSRPGKNVQLTENEIRGLC |
Rabbit Polyclonal Anti-ACTN4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACTN4 antibody: synthetic peptide directed towards the C terminal of human ACTN4. Synthetic peptide located within the following region: DVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVI |
Rabbit Polyclonal Anti-CHRM1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CHRM1 |
Rabbit Polyclonal NRAS Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
PDGF AA (PDGFA) (PDGF-AA) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Immunogen | Highly pure (>98%) E.coli derived recombinant Human PDGF-AA (Cat.-No PA118). |
PDGF beta (PDGFB) (PDGF-BB) rabbit polyclonal antibody, Biotin
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Biotin |
Immunogen | Highly pure (>98%) Recombinant Human PDGF-B. |
USD 524.00
In Stock
Rabbit Monoclonal Antibody against PPP1CB (Clone EP1804Y)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against PIK3R1 (N-term L11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This PI3KR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human PI3KR1. |
Rabbit monoclonal antibody against APC (EP701Y)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal antibody to ARPC2 (actin related protein 2/3 complex, subunit 2, 34kDa)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 14 and 300 of ARPC2 (Uniprot ID#O15144) |
Rabbit Polyclonal antibody to PP1C gamma (protein phosphatase 1, catalytic subunit, gamma isozyme)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 2 and 227 of PP1C gamma (Uniprot ID#P36873) |
Rabbit polyclonal anti-BDKRB1 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human BDKRB1. |
Modifications | Phospho-specific |
Rabbit polyclonal anti-PDGFR a antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PDGFR a. |
Rabbit Polyclonal ROCK2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ROCK2 antibody was raised against a 15 amino acid synthetic peptide near the center of human ROCK2. |
Rabbit polyclonal NRAS Antibody (N-term)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This NRAS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-101 amino acids from the N-terminal region of human NRAS. |
Rabbit polyclonal Ezrin antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Ezrin. |
Rabbit polyclonal p44/42 MAPK antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human ERK1/2. |
Rabbit anti-CDC42 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CDC42 |
Rabbit anti-CHRM1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CHRM1 |
ITGAV Rabbit Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human ITGAV |
Rabbit anti-PPP1CA Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PPP1CA |
Rabbit anti-ITGAL Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant Protein of human ITGAL |
Rabbit anti-LIMK2 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human LIMK2 |
Rabbit anti-ROCK2 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ROCK2 |
Rabbit Polyclonal Anti-ACTB Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ACTB |
Rabbit Polyclonal Anti-IQGAP3 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IQGAP3 |
Rabbit Polyclonal Anti-MYLK2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MYLK2 |
Rabbit Polyclonal LIM kinase 2 Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Integrin alpha 3 (ITGA3) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 500-550 of Human Integrin α3 |