Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Anti-ADAMTS5 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 529-541 amino acids of Human A disintegrin and metalloproteinase with thrombospondin motifs 5 |
Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8 |
| Modifications | Phospho-specific |
Rabbit anti-AHCY Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AHCY |
Rabbit Polyclonal antibody to MDH2 (malate dehydrogenase 2, NAD (mitochondrial))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 40 and 319 of MDH2 (Uniprot ID#P40926) |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal HK2 (Hexokinase II) Antibody (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HK2 (Hexokinase II) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 453-483 amino acids from the Central region of human HK2 (Hexokinase II). |
Rabbit Polyclonal PPARGC1A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A. |
XRCC2 Rabbit Polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human XRCC2 |
Rabbit Polyclonal Anti-TSG101 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSG101 antibody: synthetic peptide directed towards the C terminal of human TSG101. Synthetic peptide located within the following region: TIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY |
Rabbit polyclonal anti-TUBB(beta Tubulin) antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Chicken, Xenopus, Porcine, Zebrafish, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human beta tubulin (within residues 1-100). Swiss-Prot P07437. |
Rabbit Polyclonal Antibody against CD19 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD19 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 143-172 amino acids from the N-terminal region of human CD19. |
Rabbit polyclonal IRS-1 (Ab-312) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human IRS-1 around the phosphorylation site of serine 312 (A-T-SP-P-A). |
Rabbit polyclonal PECAM-1 (Ab-713) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
Rabbit polyclonal anti-PGC-1alpha antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 766 of mouse PGC-1alpha |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
N-cadherin Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human N-cadherin |
Rabbit Polyclonal Anti-TWIST1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TWIST1 antibody: synthetic peptide directed towards the C terminal of human TWIST1. Synthetic peptide located within the following region: DKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVW |
Rabbit Polyclonal Anti-ISG15 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ISG15 antibody: synthetic peptide directed towards the middle region of human ISG15. Synthetic peptide located within the following region: EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK |
Rabbit Polyclonal Anti-MTRR Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MTRR antibody: synthetic peptide directed towards the N terminal of human MTRR. Synthetic peptide located within the following region: YDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGL |
Rabbit Polyclonal Anti-RNF34 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RNF34 antibody: synthetic peptide directed towards the middle region of human RNF34. Synthetic peptide located within the following region: LVDLVLCHHGLGSEDDMDTSSLNSSRSQTSSFFTRSFFSNYTAPSATMSS |
Active filters
Applications
- WB
Antibody Hosts
- Rabbit
Families
- Druggable Genome
Citations
- Yes
Filter by
Category
Target Symbol
- KDR (5)
- CXCL12 (4)
- BAX (3)
- COL1A1 (3)
- PPARGC1A (3)
- RAC1 (3)
- ABCD3 (2)
- ABCG2 (2)
- ADH5 (2)
- AOX1 (2)
- BAG3 (2)
- BDNF (2)
- BRAF (2)
- CALCRL (2)
- CAMK2A (2)
- CASP9 (2)
- CCNA2 (2)
- CCNB1 (2)
- CDH2 (2)
- CTNNB1 (2)
- FBXO17 (2)
- G6PC (2)
- GAD1 (2)
- GPER1 (2)
- HMMR (2)
- HMOX1 (2)
- IRS1 (2)
- MAP3K5 (2)
- MAPK8 (2)
- MITF (2)
- MMP2 (2)
- NOS3 (2)
- OPN3 (2)
- PECAM1 (2)
- PFKFB2 (2)
- PIK3R1 (2)
- PKM (2)
- RELA (2)
- ROR2 (2)
- RXFP1 (2)
- SIGMAR1 (2)
- SLC2A1 (2)
- SNAI1 (2)
- STAT5A (2)
- TSG101 (2)
- VCL (2)
- ZEB2 (2)
- ABCB4 (1)
- ABCC2 (1)
- ABCC3 (1)
- ABCC4 (1)
- ABCC5 (1)
- ABCD2 (1)
- ACSL4 (1)
- ADAM10 (1)
- ADAM17 (1)
- ADAMTS5 (1)
- ADCY1 (1)
- AGL (1)
- AHCY (1)
- AICDA (1)
- AIMP1 (1)
- AKAP12 (1)
- AKT1 (1)
- ALPG (1)
- ANAPC10 (1)
- ANGPT2 (1)
- ANPEP (1)
- ANTXR1 (1)
- APAF1 (1)
- APOA1 (1)
- APP (1)
- AQP4 (1)
- ARSA (1)
- ASAH1 (1)
- ATG5 (1)
- ATRX (1)
- AURKB (1)
- BABAM2 (1)
- BARD1 (1)
- BCL2L10 (1)
- BCL2L11 (1)
- BCL2L2 (1)
- BCL6 (1)
- BECN1 (1)
- BID (1)
- BLK (1)
- BMP6 (1)
- BRCA1 (1)
- BRCA2 (1)
- BST2 (1)
- CACNA1B (1)
- CAMK1D (1)
- CANX (1)
- CASP3 (1)
- CASP8 (1)
- CAV1 (1)
- CBS (1)
- CCND1 (1)
- CCNE1 (1)
Reactivities
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (78)
- Focal adhesion (47)
- Metabolic pathways (46)
- MAPK signaling pathway (38)
- Chemokine signaling pathway (33)
- Pancreatic cancer (32)
- Colorectal cancer (31)
- Neurotrophin signaling pathway (31)
- Cytokine-cytokine receptor interaction (30)
- Toll-like receptor signaling pathway (28)
- Leukocyte transendothelial migration (27)
- Regulation of actin cytoskeleton (27)
- Prostate cancer (26)
- Small cell lung cancer (25)
- Insulin signaling pathway (24)
- Neuroactive ligand-receptor interaction (24)
- Chronic myeloid leukemia (23)
- ErbB signaling pathway (23)
- VEGF signaling pathway (23)
- Adipocytokine signaling pathway (22)
- Apoptosis (22)
- Amyotrophic lateral sclerosis (ALS) (21)
- Axon guidance (21)
- Natural killer cell mediated cytotoxicity (21)
- Renal cell carcinoma (21)
- p53 signaling pathway (21)
- Glioma (20)
- Huntington's disease (20)
- Melanoma (20)
- Adherens junction (19)
- Alzheimer's disease (19)
- T cell receptor signaling pathway (19)
- Wnt signaling pathway (19)
- Endocytosis (18)
- Jak-STAT signaling pathway (18)
- Non-small cell lung cancer (18)
- Progesterone-mediated oocyte maturation (18)
- Calcium signaling pathway (17)
- Endometrial cancer (17)
- Fc epsilon RI signaling pathway (17)
- Acute myeloid leukemia (16)
- B cell receptor signaling pathway (16)
- Bladder cancer (16)
- Cell cycle (16)
- Type II diabetes mellitus (16)
- Epithelial cell signaling in Helicobacter pylori infection (15)
- Fc gamma R-mediated phagocytosis (15)
- RIG-I-like receptor signaling pathway (15)
- Cell adhesion molecules (CAMs) (14)
- ECM-receptor interaction (13)
- GnRH signaling pathway (13)
- Hematopoietic cell lineage (13)
- NOD-like receptor signaling pathway (13)
- TGF-beta signaling pathway (12)
- Vascular smooth muscle contraction (12)
- Viral myocarditis (12)
- Melanogenesis (11)
- Pathogenic Escherichia coli infection (11)
- mTOR signaling pathway (11)
- ABC transporters (10)
- Gap junction (10)
- Long-term potentiation (10)
- Glycolysis / Gluconeogenesis (9)
- Long-term depression (9)
- Oocyte meiosis (9)
- PPAR signaling pathway (8)
- Prion diseases (8)
- Thyroid cancer (8)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (7)
- Cytosolic DNA-sensing pathway (7)
- Tight junction (7)
- Type I diabetes mellitus (7)
- Drug metabolism - cytochrome P450 (6)
- Lysosome (6)
- Metabolism of xenobiotics by cytochrome P450 (6)
- Parkinson's disease (6)
- Starch and sucrose metabolism (6)
- Basal cell carcinoma (5)
- Complement and coagulation cascades (5)
- Dilated cardiomyopathy (5)
- Fructose and mannose metabolism (5)
- Phosphatidylinositol signaling system (5)
- Purine metabolism (5)
- Retinol metabolism (5)
- Tyrosine metabolism (5)
- Allograft rejection (4)
- Antigen processing and presentation (4)
- Arginine and proline metabolism (4)
- Cysteine and methionine metabolism (4)
- Dorso-ventral axis formation (4)
- Galactose metabolism (4)
- Hypertrophic cardiomyopathy (HCM) (4)
- Notch signaling pathway (4)
- Porphyrin and chlorophyll metabolism (4)
- Primary immunodeficiency (4)
- Sphingolipid metabolism (4)
- Tryptophan metabolism (4)
- Ubiquitin mediated proteolysis (4)
- Alanine (3)
- Androgen and estrogen metabolism (3)
- Autoimmune thyroid disease (3)
- Butanoate metabolism (3)
- Fatty acid metabolism (3)
- Graft-versus-host disease (3)
- Homologous recombination (3)
- Olfactory transduction (3)
- Primary bile acid biosynthesis (3)
- Pyruvate metabolism (3)
- Regulation of autophagy (3)
- Renin-angiotensin system (3)
- Systemic lupus erythematosus (3)
- Taurine and hypotaurine metabolism (3)
- Valine (3)
- aspartate and glutamate metabolism (3)
- beta-Alanine metabolism (3)
- leucine and isoleucine degradation (3)
- Asthma (2)
- Base excision repair (2)
- Citrate cycle (TCA cycle) (2)
- Drug metabolism - other enzymes (2)
- Folate biosynthesis (2)
- Glycerophospholipid metabolism (2)
- Hedgehog signaling pathway (2)
- Inositol phosphate metabolism (2)
- Linoleic acid metabolism (2)
- Maturity onset diabetes of the young (2)
- Methane metabolism (2)
- Mismatch repair (2)
- Nicotinate and nicotinamide metabolism (2)
- Selenoamino acid metabolism (2)
- Vitamin B6 metabolism (2)
- Amino sugar and nucleotide sugar metabolism (1)
- Arachidonic acid metabolism (1)
- Ascorbate and aldarate metabolism (1)
- Circadian rhythm - mammal (1)
- DNA replication (1)
- Ether lipid metabolism (1)
- Glutathione metabolism (1)
- Glycine (1)
- Glycosaminoglycan degradation (1)
- Glyoxylate and dicarboxylate metabolism (1)
- Heparan sulfate biosynthesis (1)
- Other glycan degradation (1)
- Oxidative phosphorylation (1)
- Pentose and glucuronate interconversions (1)
- Pentose phosphate pathway (1)
- Propanoate metabolism (1)
- Proteasome (1)
- Pyrimidine metabolism (1)
- RNA polymerase (1)
- Riboflavin metabolism (1)
- SNARE interactions in vesicular transport (1)
- Steroid biosynthesis (1)
- Taste transduction (1)
- Thiamine metabolism (1)
- Vibrio cholerae infection (1)
- alpha-Linolenic acid metabolism (1)
- serine and threonine metabolism (1)