SPTLC1 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide derived from the Human Sserine Palmitoyltransferase enzyme |
SPTLC1 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide derived from the Human Sserine Palmitoyltransferase enzyme |
DEGS1 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide derived from the Human DEGS1 protein |
Rabbit polyclonal anti-GLB1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GLB1. |
Rabbit polyclonal Neuraminidase antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 110-124 of Human Neu2. |
Rabbit Polyclonal SPT1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | SPT1 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human SPT1. The immunogen is located within amino acids 380 - 430 of SPT1. |
Rabbit Polyclonal anti-PPAP2A antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the N terminal of human PPAP2A. Synthetic peptide located within the following region: QIYPFQRGFFCKDNSINYPYHDSTVTSTVLILVGVGLPISSIILGETLSV |
Rabbit polyclonal Anti-SMPD3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SMPD3 antibody: synthetic peptide directed towards the middle region of human SMPD3. Synthetic peptide located within the following region: RPPEADDPVPGGQARNGAGGGPRGQTPNHNQQDGDSGSLGSPSASRESLV |
Rabbit Polyclonal Anti-GALC Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GALC Antibody: synthetic peptide directed towards the middle region of human GALC. Synthetic peptide located within the following region: LMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVAL |
Rabbit Polyclonal Anti-SGPP2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SGPP2 antibody: synthetic peptide directed towards the C terminal of human SGPP2. Synthetic peptide located within the following region: SKPAESLPVIQNIPPLTTYMLVLGLTKFAVGIVLILLVRQLVQNLSLQVL |
Rabbit Polyclonal Anti-CERK Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CERK antibody is: synthetic peptide directed towards the C-terminal region of Human CERK. Synthetic peptide located within the following region: FVEVYRVKKFQFTSKHMEDEDSDLKEGGKKRFGHICSSHPSCCCTVSNSS |
Rabbit Polyclonal Anti-DEGS1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DEGS1 antibody: synthetic peptide directed towards the N terminal of human DEGS1. Synthetic peptide located within the following region: GSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMV |
Rabbit Polyclonal Anti-ACER2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACER2 antibody is: synthetic peptide directed towards the middle region of Human ACER2. Synthetic peptide located within the following region: DELAVLWVLMCALAMWFPRRYLPKIFRNDRGRFKVVVSVLSAVTTCLAFV |
Rabbit Polyclonal Anti-SGMS2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SGMS2 antibody: synthetic peptide directed towards the N terminal of human SGMS2. Synthetic peptide located within the following region: KFPLEWWKTGIAFIYAVFNLVLTTVMITVVHERVPPKELSPPLPDKFFDY |
Rabbit Polyclonal Anti-SPTLC1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SPTLC1 antibody: synthetic peptide directed towards the middle region of human SPTLC1. Synthetic peptide located within the following region: ICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGINIDDIDLI |
USD 360.00
5 Days
sphingosine 1 phosphate phosphatase 1 (SGPP1) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | Synthetic peptide derived from the sphingosine 1-phosphate phosphatase 1 protein. |
USD 360.00
5 Days
Sphingosine 1 phosphate phosphatase 2 (SGPP2) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | Synthetic peptide derived from the sphingosine 1-phosphate phosphatase 2 protein. |
SPTLC1 rabbit polyclonal antibody, Purified
Applications | WB |
Reactivities | Human |
Immunogen | Synthetic peptide derived from the human serine palmitoyltransferase enzyme |
DEGS2 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | Synthetic peptide derived from human DEGS2 protein |
DEGS2 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | Synthetic peptide derived from Human DEGS2 protein |
NSMase2 (SMPD3) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | Synthetic peptide derived from human sphingomyelin phosphodiesterase 3 |
NSMase2 (SMPD3) rabbit polyclonal antibody, Purified
Applications | WB |
Reactivities | Human |
Immunogen | Synthetic peptide derived from human sphingomyelin phosphodiesterase 3 |
DEGS1 rabbit polyclonal antibody, Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide derived from the Human DEGS1 protein. |
GBA (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | Synthetic peptide directed towards the C-term region of human Glucosylceramidase |
Sphingomyelin Synthase 2 (SGMS2) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of Human SGMS2. |
Rabbit Polyclonal Antibody against Ceramide Kinase
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human ceramide kinase protein sequence (between residues 50-150). [Swiss-Prot Q8TCT0] |
Rabbit Polyclonal ASAH2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ASAH2 antibody was raised against a 17 amino acid peptide near the carboxy terminus of the human ASAH2. |
Rabbit Polyclonal Sphingosine Kinase 1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The epitope recognized by this antibody maps to a region between residue 334-384 of human sphingosine kinase 1 using the numbering given in entry NP_001136073.1 |
Rabbit polyclonal SPHK2(Thr614) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human SPHK2 around the phosphorylation site of threonine 614 (P-L-TP-P-R). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-ACER1 (ASAH3) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ASAH3. |
Rabbit polyclonal anti-Sphingosine Kinase 1 (SPK1) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to residues surrounding amino acid 180 of mouse Sphingosine Kinase 1 |
Rabbit polyclonal SH3BP2 phospho S427 antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding aa 422-433 of Human SH3BP3 protein (SH3 Domain Binding Protein 2). |
Modifications | Phospho-specific |
Rabbit polyclonal Anti-SGMS1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SGMS1 antibody: synthetic peptide directed towards the middle region of human SGMS1. Synthetic peptide located within the following region: SCFVLTTVMISVVHERVPPKEVQPPLPDTFFDHFNRVQWAFSICEINGMI |
Rabbit Polyclonal Anti-NEU2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-NEU2 antibody is: synthetic peptide directed towards the N-terminal region of Human NEU2. Synthetic peptide located within the following region: ANVTRLCQVTSTDHGRTWSSPRDLTDAAIGPAYREWSTFAVGPGHCLQLH |
Rabbit Polyclonal Anti-ENPP7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ENPP7 Antibody is: synthetic peptide directed towards the middle region of Human ENPP7. Synthetic peptide located within the following region: DLDLVTLYFGEPDSTGHRYGPESPERREMVRQVDRTVGYLRESIARNHLT |
Rabbit Polyclonal Anti-ENPP7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ENPP7 Antibody is: synthetic peptide directed towards the N-terminal region of Human ENPP7. Synthetic peptide located within the following region: WITAQRQGLRAGSFFYPGGNVTYQGVAVTRSRKEGIAHNYKNETEWRANI |
Rabbit Polyclonal Anti-SGPL1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SGPL1 antibody is: synthetic peptide directed towards the C-terminal region of Human SGPL1. Synthetic peptide located within the following region: IHFCITLLHARKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQTT |
Rabbit Polyclonal Anti-SGMS2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SGMS2 antibody: synthetic peptide directed towards the N terminal of human SGMS2. Synthetic peptide located within the following region: KFPLEWWKTGIAFIYAVFNLVLTTVMITVVHERVPPKELSPPLPDKFFDY |
Rabbit Polyclonal Anti-SPTLC1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SPTLC1 antibody: synthetic peptide directed towards the middle region of human SPTLC1. Synthetic peptide located within the following region: DLERLLKEQEIEDQKNPRKARVTRRFIVVEGLYMNTGTICPLPELVKLKY |
Rabbit Polyclonal Anti-SMPD1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SMPD1 antibody: synthetic peptide directed towards the middle region of human SMPD1. Synthetic peptide located within the following region: INSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIV |
Rabbit Polyclonal Anti-SGPP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SGPP1 antibody: synthetic peptide directed towards the middle region of human SGPP1. Synthetic peptide located within the following region: THKYAPFIIIGLHLALGIFSFTLDTWSTSRGDTAEILGSGAGIACGSHVT |
Rabbit Polyclonal Anti-NEU4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NEU4 antibody: synthetic peptide directed towards the N terminal of human NEU4. Synthetic peptide located within the following region: TGTVFLFFIAVLGHTPEAVQIATGRNAARLCCVASRDAGLSWGSARDLTE |
Rabbit Polyclonal Anti-SPHK1 Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | SPHK / SPHK1 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human SPHK1. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Gorilla, Dog, Bat, Elephant, Panda, Rabbit (93%); Horse (87%); Mouse, Rat, Bovine (80%). |
Rabbit Polyclonal Anti-SPHK1 Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human |
Immunogen | SPHK / SPHK1 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human SPHK1. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey (93%); Bat, Pig (87%); Mouse, Rat, Hamster (80%). |
Rabbit Polyclonal Anti-CERK Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Ceramide Kinase / CERK antibody was raised against synthetic 14 amino acid peptide from internal region of human CERK. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Panda (100%); Gorilla, Dog, Elephant, Horse (93%); Mouse, Rat, Hamster (86%). |
Rabbit Polyclonal Anti-CERK Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Ceramide Kinase / CERK antibody was raised against synthetic 20 amino acid peptide from N-terminal extracellular domain of human CERK. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey, Marmoset (90%); Dog, Panda (85%); Bovine, Elephant, Rabbit (80%). |
Rabbit Polyclonal Anti-SPHK1 Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human |
Immunogen | SPHK / SPHK1 antibody was raised against synthetic 15 amino acid peptide from N-Terminus of human SPHK1. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Gorilla, Elephant, Panda, Dog, Bat, Rabbit (93%); Horse (87%); Bovine (80%). |
Rabbit Polyclonal Anti-Smpd4 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Smpd4 antibody is: synthetic peptide directed towards the middle region of Rat Smpd4. Synthetic peptide located within the following region: LHSPAQPSLQALHAYQESFMPTEEHVLVVRLLLKHLHAFANSLKPDQASP |
Rabbit Polyclonal Anti-ACER1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACER1 antibody: synthetic peptide directed towards the C terminal of human ACER1. Synthetic peptide located within the following region: ITFPYGMVTMALVDANYEMPGETLKVRYWPRDSWPVGLPYVEIRGDDKDC |
Rabbit anti SPHK1 Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti SPHK2 Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A recombinant protein encoding the full length of 618 aa human SPHK2. |