Germany
Japan
United Kingdom
China
Biotinylated Anti-Human IL-17E Rabbit Polyclonal Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human IL-17E |
Antibodies
Download
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit anti-IL7R Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL7R |
USD 380.00
In Stock
Rabbit Polyclonal VEGFR2 (Tyr1214) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human VEGFR2 around the phosphorylation site of Tyrosine 1214 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-AMH Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AMH Antibody: synthetic peptide directed towards the middle region of human AMH. Synthetic peptide located within the following region: SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG |
Rabbit anti-LTBR Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LTBR |
Rabbit Polyclonal Anti-IL-12A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL-12A antibody was raised against an 18 amino acid peptide near the carboxy terminus of human IL-12A. The immunogen is located within the last 50 amino acids of IL-12A. |
Rabbit Polyclonal CX3CR1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CX3CR1 antibody was raised against a 20 amino acid peptide near the amino terminus of human CX3CR1. The immunogen is located within the first 50 amino acids of CX3CR1. |
Rabbit polyclonal TGFBR2 (Ab-250) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TGFBR2 around the phosphorylation site of serine 250 (D-R-SP-D-I). |
Rabbit polyclonal IL1R Antibody (C-term E487)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL1R antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 474-503 amino acids from the C-terminal region of human IL1R. |
Rabbit Polyclonal Anti-Interleukin 12A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Interleukin 12A Antibody: A synthesized peptide derived from human Interleukin 12A |
SDF1 (CXCL12) (alpha) rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) E.coli derived recombinant Human SDF1-alpha (Cat.-No PA126) |
Rabbit Polyclonal CXCR4 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CXCR4 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human CXCR4. The immunogen is located within the first 50 amino acids of CXCR4. |
Active filters
Antibody Hosts
- Rabbit
Pathways
- Cytokine-cytokine receptor interaction
Filter by
Target Symbol
- EGFR (79)
- AMH (39)
- KDR (37)
- MET (23)
- PDGFRB (22)
- CSF1R (21)
- KIT (17)
- CXCR4 (15)
- EGF (15)
- PDGFB (15)
- EPOR (13)
- IL4 (13)
- TNFSF11 (13)
- CXCL12 (12)
- FLT1 (12)
- KITLG (12)
- NGFR (12)
- TNFRSF10B (12)
- IL2 (11)
- IL7 (11)
- LEP (11)
- PDGFA (11)
- TNFSF13 (11)
- VEGFA (11)
- CCL2 (10)
- CCL27 (10)
- CCR7 (10)
- FAS (10)
- FLT3 (10)
- IFNB1 (10)
- IL1B (10)
- IL9 (10)
- TGFBR2 (10)
- TNFRSF11B (10)
- TNFRSF1A (10)
- CCR5 (9)
- CD70 (9)
- CX3CR1 (9)
- IFNG (9)
- PDGFRA (9)
- TGFB1 (9)
- TNF (9)
- TNFRSF1B (9)
- VEGFB (9)
- CCL28 (8)
- CCR8 (8)
- CD40 (8)
- CSF2 (8)
- CXCR2 (8)
- CXCR3 (8)
- EDA (8)
- FASLG (8)
- IL10RA (8)
- IL19 (8)
- IL2RB (8)
- TGFB2 (8)
- TGFBR1 (8)
- TNFRSF11A (8)
- TNFSF10 (8)
- TSLP (8)
- ACVR1 (7)
- CCR3 (7)
- CSF1 (7)
- IL10 (7)
- IL12A (7)
- IL17A (7)
- IL21 (7)
- IL22 (7)
- IL6 (7)
- PRL (7)
- TNFRSF25 (7)
- BMP2 (6)
- BMP7 (6)
- CD40LG (6)
- CNTF (6)
- CTF1 (6)
- CX3CL1 (6)
- CXCL1 (6)
- FLT4 (6)
- IFNAR1 (6)
- IFNL2 (6)
- IL11RA (6)
- IL18R1 (6)
- IL22RA1 (6)
- IL23A (6)
- IL2RA (6)
- IL6ST (6)
- INHBA (6)
- TNFSF14 (6)
- TNFSF15 (6)
- TNFSF4 (6)
- ACVR1B (5)
- BMPR2 (5)
- CCL5 (5)
- CCR1 (5)
- CSF2RA (5)
- CSF3 (5)
- CXCL14 (5)
- CXCL8 (5)
- EPO (5)
Reactivities
Applications
Isotypes
Clonalities
Conjugates
Modifications
Families
- Druggable Genome (1445)
- Transmembrane (946)
- Secreted Protein (796)
- ES Cell Differentiation/IPS (360)
- Protein Kinase (285)
- Adult stem cells (139)
- GPCR (103)
- Cancer stem cells (93)
- Stem cell relevant signaling - JAK/STAT signaling pathway (82)
- Embryonic stem cells (51)
- Induced pluripotent stem cells (32)
- Transcription Factors (30)
- Stem cell - Pluripotency (22)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (14)
- Protease (5)
- Stem cell relevant signaling - DSL/Notch pathway (3)