Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-STAT1 (Phospho-Tyr701) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT1 around the phosphorylation site of tyrosine 701 (T-G-YP-I-K). |
| Modifications | Phospho-specific |
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit Polyclonal Anti-SOCS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOCS1 antibody: synthetic peptide directed towards the N terminal of human SOCS1. Synthetic peptide located within the following region: RRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRSHADYRRITRA |
Rabbit anti-IL7R Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL7R |
Rabbit anti-STAT3 (Phospho-Tyr705) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT3 around the phosphorylation site of tyrosine 705 (A-P-YP-L-K). |
| Modifications | Phospho-specific |
Cyclin D1 (CCND1) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to amino acids 55-100 of Human Cyclin D1. |
Rabbit Polyclonal Anti-IL-12A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL-12A antibody was raised against an 18 amino acid peptide near the carboxy terminus of human IL-12A. The immunogen is located within the last 50 amino acids of IL-12A. |
Rabbit Polyclonal Anti-Interleukin 12A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Interleukin 12A Antibody: A synthesized peptide derived from human Interleukin 12A |
Rabbit Polyclonal Antibody against PIK3CA (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KCA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 504-533 amino acids from the Central region of human PI3KCA. |
USD 515.00
In Stock
Rabbit polyclonal JAK2 (Tyr570) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human JAK2 around the phosphorylation site of tyrosine 750 (G-D-YP-G-Q). |
| Modifications | Phospho-specific |
Rabbit Polyclonal PI3-kinase p85- alpha (Tyr607) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PI3-kinase p85- alpha around the phosphorylation site of Tyrosine 607 |
| Modifications | Phospho-specific |
Rabbit Polyclonal STAT5A (Ser780) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human STAT5A around the phosphorylation site of Serine 780 |
| Modifications | Phospho-specific |
Rabbit Polyclonal STAT5A/B (Ser725/730) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human STAT5A/B around the phosphorylation site of Serine 725/730 |
| Modifications | Phospho-specific |
IFNAR2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IFNAR2 |
CBLB Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CBLB |
Rabbit Polyclonal Anti-CSH1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CSH1 antibody: synthetic peptide directed towards the middle region of human CSH1. Synthetic peptide located within the following region: SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYS |
Rabbit Polyclonal Anti-LEP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LEP antibody: synthetic peptide directed towards the N terminal of human LEP. Synthetic peptide located within the following region: MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQS |
Rabbit Polyclonal Anti-P300/CBP Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P300/CBP Antibody: A synthesized peptide derived from human P300/CBP |
IL5RA rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide, corresponding to amino acids 50-100 of Human IL-5Rα. |
Active filters
Antibody Hosts
- Rabbit
Pathways
- Jak-STAT signaling pathway
Filter by
Category
Target Symbol
- AKT1 (60)
- STAT1 (27)
- MYC (24)
- STAT3 (24)
- JAK2 (20)
- PTPN11 (19)
- BCL2L1 (18)
- STAT6 (17)
- STAT5A (15)
- CCND1 (14)
- PIK3R1 (14)
- STAT5B (14)
- EPOR (13)
- IL4 (13)
- SOCS1 (13)
- AKT2 (12)
- IL2 (11)
- IL7 (11)
- LEP (11)
- IFNB1 (10)
- IL9 (10)
- JAK1 (10)
- CBL (9)
- EP300 (9)
- IFNG (9)
- PIAS1 (9)
- PIAS2 (9)
- STAT2 (9)
- STAT4 (9)
- CSF2 (8)
- GRB2 (8)
- IL10RA (8)
- IL19 (8)
- IL2RB (8)
- TSLP (8)
- TYK2 (8)
- CCND3 (7)
- CREBBP (7)
- IL10 (7)
- IL12A (7)
- IL21 (7)
- IL22 (7)
- IL6 (7)
- PIM1 (7)
- PRL (7)
- AKT3 (6)
- CCND2 (6)
- CNTF (6)
- CTF1 (6)
- IFNAR1 (6)
- IFNL2 (6)
- IL11RA (6)
- IL22RA1 (6)
- IL23A (6)
- IL2RA (6)
- IL6ST (6)
- PIAS3 (6)
- CSF2RA (5)
- CSF3 (5)
- CSH1 (5)
- EPO (5)
- GH2 (5)
- IFNL3 (5)
- IL15 (5)
- IL20 (5)
- IL3 (5)
- IL4R (5)
- IL5 (5)
- PIK3CD (5)
- PRLR (5)
- PTPN6 (5)
- SOCS2 (5)
- CLCF1 (4)
- GH1 (4)
- GHR (4)
- IFNGR1 (4)
- IL11 (4)
- IL12RB2 (4)
- IL13 (4)
- IL13RA1 (4)
- IL13RA2 (4)
- IL15RA (4)
- IL23R (4)
- IL2RG (4)
- JAK3 (4)
- LIF (4)
- PIAS4 (4)
- PIK3CA (4)
- PIK3CB (4)
- PIK3CG (4)
- PIK3R3 (4)
- SOCS5 (4)
- SOCS7 (4)
- CNTFR (3)
- CRLF2 (3)
- CSF3R (3)
- IFNGR2 (3)
- IL12RB1 (3)
- IL20RA (3)
- IL21R (3)
Reactivities
Applications
Clonalities
Conjugates
Modifications
Families
- Druggable Genome (862)
- Secreted Protein (282)
- ES Cell Differentiation/IPS (211)
- Transmembrane (204)
- Transcription Factors (187)
- Protein Kinase (127)
- Stem cell relevant signaling - JAK/STAT signaling pathway (109)
- Stem cell - Pluripotency (65)
- Stem cell relevant signaling - DSL/Notch pathway (49)
- Stem cell relevant signaling - Wnt Signaling pathway (38)
- Embryonic stem cells (24)
- Induced pluripotent stem cells (24)
- Phosphatase (24)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (24)
- Adult stem cells (4)