Germany
Japan
United Kingdom
China
Rabbit monoclonal anti-CDKN2A / p16INK4A (anti-CD2A1) antibody for SISCAPA, clone OTIR3C4
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Cyclin D1 (CCND1) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to amino acids 55-100 of Human Cyclin D1. |
Rabbit Polyclonal p53 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p53 antibody: human p53 (tumor protein p53), using a KLH-conjugated synthetic peptide containing a sequence from the C-terminal part of the protein. |
Rabbit Polyclonal Antibody against PIK3CA (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KCA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 504-533 amino acids from the Central region of human PI3KCA. |
Rabbit polyclonal p16-INK4a (Phospho-Ser152) antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human p16-INK4a around the phosphorylation site of serine 152 (G-P-SP-D-I). |
| Modifications | Phospho-specific |
Rabbit Polyclonal PI3-kinase p85- alpha (Tyr607) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PI3-kinase p85- alpha around the phosphorylation site of Tyrosine 607 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Antibody against BRAF (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This B-RAF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 424-453 amino acids from the Central region of human B-RAF. |
Rabbit anti-BAD (Phospho-Ser112) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanBAD around the phosphorylation site of serine 112 (H-S-SP-Y-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal Caspase 9 (Tyr153) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of tyrosine 153 (L-A-YP-I-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C). |
| Modifications | Phospho-specific |
Rabbit polyclonal SOS2 Antibody (N-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SOS2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 188-215 amino acids from the N-terminal region of human SOS2. |
Rabbit Polyclonal Antibody against PIK3R1 (N-term L11)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human PI3KR1. |
Rabbit Polyclonal Antibody against AKT2 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This AKT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-123 amino acids from the N-terminal region of human AKT2. |
Rabbit monoclonal antibody against Rb (clone EP44(2) )
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal CDK4 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CDK4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 273-305 amino acids from the C-terminal region of human CDK4. |
Rabbit polyclonal NRAS Antibody (N-term)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NRAS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-101 amino acids from the N-terminal region of human NRAS. |
Rabbit Polyclonal Anti-RXRA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RXRA Antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI |
Rabbit anti-AKT1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human AKT1 |
Active filters
Antibody Hosts
- Rabbit
Pathways
- Non-small cell lung cancer
Filter by
Category
Target Symbol
- EGFR (79)
- AKT1 (60)
- TP53 (49)
- ERBB2 (30)
- MAP2K1 (26)
- RAF1 (26)
- CASP9 (25)
- BAD (21)
- BRAF (20)
- CDKN2A (17)
- RB1 (17)
- PRKCA (16)
- EGF (15)
- CCND1 (14)
- MAPK3 (14)
- PIK3R1 (14)
- PLCG1 (14)
- MAPK1 (13)
- AKT2 (12)
- FOXO3 (12)
- PRKCB (11)
- E2F1 (10)
- E2F2 (9)
- PDPK1 (9)
- PLCG2 (9)
- CDK6 (8)
- FHIT (8)
- GRB2 (8)
- MAP2K2 (8)
- NRAS (8)
- RARB (7)
- AKT3 (6)
- PRKCG (6)
- RXRB (6)
- TGFA (6)
- PIK3CD (5)
- RASSF1 (5)
- RXRA (5)
- RXRG (5)
- ARAF (4)
- CDK4 (4)
- HRAS (4)
- PIK3CA (4)
- PIK3CB (4)
- PIK3CG (4)
- PIK3R3 (4)
- SOS2 (3)
- E2F3 (2)
- PIK3R5 (2)
- RASSF5 (2)
- KRAS (1)
- PIK3R2 (1)
- SOS1 (1)
- STK4 (1)
Reactivities
Applications
Clonalities
Conjugates
Modifications
Families
- Druggable Genome (663)
- Protein Kinase (353)
- ES Cell Differentiation/IPS (206)
- Transmembrane (130)
- Transcription Factors (122)
- Adult stem cells (94)
- Stem cell relevant signaling - JAK/STAT signaling pathway (93)
- Stem cell - Pluripotency (88)
- Secreted Protein (85)
- Cancer stem cells (79)
- Protease (25)
- Nuclear Hormone Receptor (23)
- Embryonic stem cells (15)
- Induced pluripotent stem cells (15)
- Stem cell relevant signaling - DSL/Notch pathway (14)
- Stem cell relevant signaling - Wnt Signaling pathway (14)