Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Cyclin D1 (CCND1) mouse monoclonal antibody, clone CD1.1
| Applications | ELISA, FC, IF, IHC, IP, WB |
| Reactivities | Human, Rat |
USD 300.00
2 Weeks
p53 (TP53) (Wild type + Mutant) (20-31) mouse monoclonal antibody, clone Bp53-11, Aff - Purified
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human |
IGF1 mouse monoclonal antibody, clone M23/ILG1-001, Purified
| Applications | ELISA, R |
| Reactivities | Human |
Rabbit Polyclonal 14-3-3 sigma/Stratifin Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
DR5 (TNFRSF10B) rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Canine, Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) 14,9 kDa recombinant Human soluble TRAIL Receptor-2. |
Rabbit Polyclonal CDKN2A/p16INK4a Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal MDM2 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal MDM2 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal MDM2 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal TRAIL-R2 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Caspase 8 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal p73 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal PPM1D Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
CDK4 mouse monoclonal antibody, clone AT6D10, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
CDK4 mouse monoclonal antibody, clone AT6D10, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
DR5 (TNFRSF10B) rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) 14,9 kDa recombinant Human soluble TRAIL Receptor-2. |
DR5 (TNFRSF10B) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Immunogen | Highly pure (>98%) recombinant Human soluble TRAIL Receptor-2. |
DR5 (TNFRSF10B) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Immunogen | Highly pure (>98%) recombinant Human soluble TRAIL Receptor-2. |
IGF1 rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | E.coli derived recombinant Human IGF-I (Cat.-No PA071) |
IGF1 rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | E.coli derived recombinant Human IGF-I (Cat.-No PA071) |
Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP |
Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Anti-Human sTRAIL Receptor-2 Rabbit Polyclonal Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Human sTRAIL Receptor-2 |
Anti-TP53 Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 1-233 amino acids of human tumor protein p53 |
Active filters
Applications
- ELISA
Pathways
- p53 signaling pathway
Filter by
Category
Target Symbol
Reactivities
Antibody Hosts
Clonalities
Conjugates
Assay Types
Assay Platforms
Families
- Druggable Genome (63)
- Secreted Protein (17)
- Stem cell - Pluripotency (11)
- Transmembrane (11)
- ES Cell Differentiation/IPS (10)
- Transcription Factors (10)
- Protein Kinase (7)
- Protease (5)
- Phosphatase (1)
- Stem cell relevant signaling - DSL/Notch pathway (1)
- Stem cell relevant signaling - JAK/STAT signaling pathway (1)
- Stem cell relevant signaling - Wnt Signaling pathway (1)