Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Rabbit polyclonal PECAM-1 (Ab-713) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
Rabbit Polyclonal Anti-SPIB Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SPIB antibody was raised against a 17 amino acid peptide near the carboxy terminus of human SPIB. The immunogen is located within amino acids 200 - 250 of SPIB. |
Goat Polyclonal Anti-BDNF Antibody
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BDNF Antibody: Peptide with sequence ETKCNPMGYTKE, from the internal region of the protein sequence according to NP_001700.2; NP_001700.2; NP_733928.1; NP_733929.1; NP_733930.1; NP_733931.1. |
Rabbit polyclonal anti-LAMA1 antibody
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LAMA1. |
Rabbit Polyclonal CXCR4 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CXCR4 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human CXCR4. The immunogen is located within the first 50 amino acids of CXCR4. |
Rabbit polyclonal KLF6 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This KLF6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 159-186 amino acids from the C-terminal region of human KLF6. |
Rabbit polyclonal EMX1 Antibody (C-term)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This EMX1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 228-257 amino acids from the C-terminal region of human EMX1. |
Rabbit Polyclonal Anti-TRIM33 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM33 antibody: synthetic peptide directed towards the middle region of human TRIM33. Synthetic peptide located within the following region: EIYSDRTFAPLPEFEQEEDDGEVTEDSDEDFIQPRRKRLKSDERPVHIK |
Rabbit Polyclonal Antibody against SOX2 - Embryonic Stem Cell Marker
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Sheep |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human SOX2 protein (within residues 1-100). [Swiss-Prot# P48431] |
Rabbit polyclonal PECAM-1 (Tyr713) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
| Modifications | Phospho-specific |
Rabbit polyclonal RUNX1 Antibody (S276)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RUNX1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 227-255 amino acids from human RUNX1. |
Rabbit polyclonal KLF5 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This KLF5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 341-370 amino acids from the C-terminal region of human KLF5. |
Rabbit polyclonal SMAD3-S208 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3. |
Goat Polyclonal Anti-ICAM1 (aa313-327) Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ICAM1 (aa313-327) Antibody: Peptide with sequence C-PNVILTKPEVSEGTE, from the internal region of the protein sequence according to NP_000192.2. |
Rabbit Polyclonal CCR5 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CCR5 antibody was raised against a 15 amino acid peptide near the amino terminus of human CCR5. The immunogen is located within the first 50 amino acids of CCR5. |
Rabbit Polyclonal GATA3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GATA3 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human GATA3. The immunogen is located within amino acids 340 - 390 of GATA3. |
Rabbit polyclonal anti-FSHR antibody
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FSHR. |
Rabbit polyclonal SOX4 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SOX4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 86-114 amino acids from the N-terminal region of human SOX4. |
Rabbit Polyclonal Ki-67/MKI67 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Porcine |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of human Ki67 (within residues 1550-1700) [Swiss-Prot# P46013] |
TA336650 is a possible alternative to TA336566.
GFAP rabbit polyclonal antibody, Purified
| Applications | IF, IHC |
| Reactivities | Bovine, Guinea Pig, Human, Mouse, Porcine, Rat |
| Immunogen | Purified Human GFAP. |
Active filters
Applications
- IF
Isotypes
- IgG
Clonalities
- Polyclonal
Families
- ES Cell Differentiation/IPS
Filter by
Category
Target Symbol
- GAPDH (9)
- AKT1 (8)
- GATA3 (4)
- KLF4 (4)
- ACTB (3)
- BCL2 (3)
- BMI1 (3)
- CTNNB1 (3)
- CXCR4 (3)
- FOXA2 (3)
- ITGA4 (3)
- KDR (3)
- LAMP1 (3)
- NANOG (3)
- PECAM1 (3)
- SMAD2 (3)
- SOX2 (3)
- VIM (3)
- AKT2 (2)
- AXIN2 (2)
- BCL2L1 (2)
- CSF1 (2)
- CSNK1A1 (2)
- DDX3X (2)
- EGFR (2)
- FLT3 (2)
- FSHR (2)
- GATA1 (2)
- GATA6 (2)
- GCG (2)
- GFAP (2)
- GLI3 (2)
- HES5 (2)
- HNF1A (2)
- JAG1 (2)
- MAPK8 (2)
- MKI67 (2)
- PDGFRB (2)
- PROM1 (2)
- SIPA1 (2)
- SLC2A1 (2)
- SMAD3 (2)
- SMAD9 (2)
- SOX4 (2)
- SOX9 (2)
- TDGF1 (2)
- TRIM33 (2)
- YBX1 (2)
- ALDH1A1 (1)
- AXIN1 (1)
- BDNF (1)
- BMP15 (1)
- BTC (1)
- CASP3 (1)
- CCR5 (1)
- CD244 (1)
- CD38 (1)
- CD44 (1)
- CD81 (1)
- CDCA4 (1)
- CDH1 (1)
- CDH2 (1)
- CDX2 (1)
- DBX2 (1)
- DLK1 (1)
- DVL1 (1)
- DVL3 (1)
- EMX1 (1)
- EN1 (1)
- EN2 (1)
- FGF18 (1)
- FGF4 (1)
- FLII (1)
- GLIS2 (1)
- GLP1R (1)
- HAND1 (1)
- HCRTR1 (1)
- HNF4A (1)
- HOXD8 (1)
- ICAM1 (1)
- IGFBP2 (1)
- IL2RA (1)
- IL7R (1)
- ITGA6 (1)
- JMJD6 (1)
- JUN (1)
- KLF5 (1)
- KLF6 (1)
- KRT7 (1)
- LAMA1 (1)
- LAMP2 (1)
- LEF1 (1)
- LIF (1)
- LMX1A (1)
- MAPK6 (1)
- MYB (1)
- NES (1)
- NEUROD1 (1)
- NKX2-1 (1)
- PDGFRA (1)
Reactivities
Antibody Hosts
Conjugates
Modifications
Pathways
- Pathways in cancer (53)
- Colorectal cancer (36)
- Focal adhesion (36)
- MAPK signaling pathway (22)
- Prostate cancer (22)
- Pancreatic cancer (21)
- Endometrial cancer (20)
- Cytokine-cytokine receptor interaction (19)
- Wnt signaling pathway (19)
- ErbB signaling pathway (18)
- Leukocyte transendothelial migration (18)
- Melanoma (18)
- Neurotrophin signaling pathway (17)
- Small cell lung cancer (17)
- Tight junction (17)
- Adherens junction (16)
- Apoptosis (16)
- Chronic myeloid leukemia (16)
- Jak-STAT signaling pathway (16)
- Acute myeloid leukemia (15)
- Glioma (15)
- Adipocytokine signaling pathway (14)
- Chemokine signaling pathway (14)
- Regulation of actin cytoskeleton (14)
- VEGF signaling pathway (14)
- Basal cell carcinoma (13)
- Renal cell carcinoma (13)
- Toll-like receptor signaling pathway (13)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (12)
- B cell receptor signaling pathway (12)
- Endocytosis (12)
- Fc epsilon RI signaling pathway (12)
- Hematopoietic cell lineage (12)
- Insulin signaling pathway (12)
- Non-small cell lung cancer (12)
- Progesterone-mediated oocyte maturation (12)
- Metabolic pathways (11)
- T cell receptor signaling pathway (11)
- Alzheimer's disease (10)
- Cell adhesion molecules (CAMs) (10)
- Fc gamma R-mediated phagocytosis (10)
- mTOR signaling pathway (10)
- Glycolysis / Gluconeogenesis (9)
- Maturity onset diabetes of the young (8)
- TGF-beta signaling pathway (8)
- Dilated cardiomyopathy (7)
- Epithelial cell signaling in Helicobacter pylori infection (7)
- Hypertrophic cardiomyopathy (HCM) (7)
- Pathogenic Escherichia coli infection (7)
- Amyotrophic lateral sclerosis (ALS) (6)
- Calcium signaling pathway (6)
- ECM-receptor interaction (6)
- Gap junction (6)
- GnRH signaling pathway (6)
- Hedgehog signaling pathway (6)
- Melanogenesis (6)
- Notch signaling pathway (6)
- Cell cycle (5)
- Thyroid cancer (5)
- Viral myocarditis (5)
- Lysosome (4)
- Neuroactive ligand-receptor interaction (4)
- RIG-I-like receptor signaling pathway (4)
- Axon guidance (3)
- Bladder cancer (3)
- Natural killer cell mediated cytotoxicity (3)
- Type II diabetes mellitus (3)
- Vibrio cholerae infection (3)
- Dorso-ventral axis formation (2)
- Huntington's disease (2)
- NOD-like receptor signaling pathway (2)
- Nicotinate and nicotinamide metabolism (1)
- Oxidative phosphorylation (1)
- Parkinson's disease (1)
- Primary immunodeficiency (1)
- Retinol metabolism (1)
- p53 signaling pathway (1)