Germany
Japan
United Kingdom
China
Antibodies
USD 420.00
In Stock
Rabbit Polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 194 and 475 of MX1 (Uniprot ID#P20591) |
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
Rabbit Polyclonal OCLN Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | OCLN antibody was raised against a 15 amino acid synthetic peptide from near the carboxy terminus of human OCLN. The immunogen is located within the last 50 amino acids of OCLN. |
Calca rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Human, Mammalian, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic rat alpha-CGRP coupled to bovine thyroglobulin (BTg) with glutaraldehyde. |
Rabbit Polyclonal Anti-HNRPH1 Antibody - middle region
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPH1 antibody: synthetic peptide directed towards the middle region of human HNRPH1. Synthetic peptide located within the following region: FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG |
Rabbit Polyclonal H3K9/14ac Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K9/14ac antibody: histone H3 acetylated at lysines 9 and 14 (H3K9/14ac), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal Anti-TET1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | TET1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human TET1. The immunogen is located within amino acids 2030 - 2080 of TET1. |
USD 479.00
2 Weeks
Rabbit Polyclonal IRAK-M Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
USD 399.00
In Stock
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
Rabbit Polyclonal FOXP3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal FOXP3 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human FOXP3. The immunogen is located within the last 50 amino acids of FOXP3. |
Rabbit Polyclonal Anti-HNRPA0 Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPA0 antibody: synthetic peptide directed towards the middle region of human HNRPA0. Synthetic peptide located within the following region: KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG |
Rabbit Polyclonal Anti-HNRPUL1 Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPUL1 antibody: synthetic peptide directed towards the C terminal of human HNRPUL1. Synthetic peptide located within the following region: TYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNYDYGSYSGNTQGGTSTQ |
Rabbit Polyclonal Antibody against XCT
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
Active filters
Reactivities
- Human
Applications
- IF
Filter by
Target Symbol
- MAP2K1 (205)
- PDCD1 (137)
- MAP2K3 (133)
- CTAG1B (131)
- LIPG (107)
- KLK8 (106)
- TP53 (106)
- ERCC1 (97)
- CDKN2A (86)
- MAPK13 (86)
- L1CAM (84)
- ERBB2 (82)
- PNMT (80)
- VIM (78)
- MDM4 (75)
- PECAM1 (68)
- SQSTM1 (65)
- APP (64)
- LOX (64)
- MLANA (61)
- BSG (60)
- IDO1 (60)
- PTPRE (60)
- AKT1 (58)
- NPR3 (58)
- EPCAM (57)
- PSMC3 (57)
- ACAT2 (56)
- CTNNB1 (56)
- PDE4A (56)
- SENP2 (56)
- CCT8L2 (55)
- MAPK7 (55)
- MCL1 (55)
- MIOX (55)
- MOB3B (55)
- MTRF1L (55)
- NME4 (55)
- BUB1B (54)
- CD19 (54)
- GFAP (54)
- IGF2BP2 (54)
- CDK2 (53)
- CD163 (52)
- SYP (52)
- TACC3 (52)
- UBE2G2 (52)
- BTK (51)
- CHGA (51)
- BTN1A1 (50)
- FAHD2A (50)
- LENG1 (50)
- LIMK1 (50)
- MAPRE2 (50)
- PIK3AP1 (50)
- RNF144B (50)
- SMS (50)
- SPG7 (50)
- VWA5A (50)
- BECN1 (49)
- CD80 (48)
- SNAP25 (48)
- ERG (47)
- KRT7 (47)
- PGAM2 (47)
- SOCS3 (47)
- GBP2 (46)
- HIBCH (46)
- SNX9 (46)
- ARHGAP25 (45)
- CCM2 (45)
- CD1C (45)
- ELK3 (45)
- FOXI1 (45)
- HOXC11 (45)
- PARVA (45)
- PIK3R5 (45)
- TAL1 (45)
- ALDH1L1 (44)
- ERCC4 (44)
- AFP (43)
- POR (43)
- SAMHD1 (43)
- ATP5F1B (42)
- MYC (42)
- PRKAR2A (42)
- PYCR2 (42)
- ACAA2 (41)
- CRYAB (41)
- DTYMK (41)
- RASSF1 (41)
- ARFGAP1 (40)
- CD33 (40)
- DYNC1LI1 (40)
- LRATD2 (40)
- MICAL1 (40)
- MMP13 (40)
- NHEJ1 (40)
- PRKCE (40)
- PYCR3 (40)
Antibody Hosts
Isotypes
- IgG1 (10680)
- IgG (7090)
- IgG2a (3477)
- IgG2b (2914)
- IgG1, kappa (113)
- IgG, kappa (100)
- IgG3 (88)
- Ig (36)
- IgG2a, kappa (34)
- IgY (28)
- IgM (22)
- Fab fragment, kappa (14)
- IgG2b, kappa (14)
- IgM, kappa (8)
- IgG1, lambda (4)
- IgG3, kappa (2)
- F(ab)2, kappa (1)
- IgG1/IgK (1)
- IgG2, kappa (1)
- IgG2a, lambda (1)
- IgG2b, lambda (1)
- IgG4 (1)
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
- Unmodified (2430)
- Phospho-specific (142)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. (29)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. (14)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human Fab format, for improved compatibility with existing reagents, assays and techniques. (12)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG1 format, for improved compatibility with existing reagents, assays and techniques. (7)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2b format, for improved compatibility with existing reagents, assays and techniques. (6)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (4)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgM format, for improved compatibility with existing reagents, assays and techniques. (4)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG2a format, for improved compatibility with existing reagents, assays and techniques. (4)
- Acetyl K5 (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2a format, for improved compatibility with existing reagents, assays and techniques. (3)
- This is a chimeric antibody created for improved compatibility with existing reagents, assays and techniques. (3)
- Acetyl K12 (2)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. (2)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This is a chimeric antibody created for improved compatibility with existing reagents, assays and techniques. (2)
- This chimeric mouse antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original human scFv format, for improved compatibility with existing reagents, assays and techniques. (2)
- TriMethyl K56 (2)
- Acetyl K14 (1)
- Acetyl K15 (1)
- Acetyl K16 (1)
- Acetyl K18 (1)
- Acetyl K23 (1)
- Acetyl K27 (1)
- Acetyl K29 (1)
- Acetyl K36 (1)
- Acetyl K4 (1)
- Acetyl K56 (1)
- Acetyl K8 (1)
- Acetyl K9 (1)
- Acetyl K9/K14/K18/K23/K27 (1)
- Acetyl K91 (1)
- Asymmetric DiMethyl R3 (1)
- MonoMethyl K36 (1)
- MonoMethyl K5 (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric mouse antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- Pan DiMethyl-lysine (1)
- Pan Phospho-Tyrosine (1)
- Phospho S10 (1)
- Phospho S10/T11 (1)
- Phospho S2056 (1)
- Phospho S241 (1)
- Phospho S2448 (1)
- Phospho S28 (1)
- Phospho S428 (1)
- Phospho S465/467 + S423/425 (1)
- Phospho S519/T522 (1)
- Phospho S70 (1)
- Phospho S9 (1)
- Phospho Ser404 (1)
- Phospho Ser416 (1)
- Phospho T11 (1)
- Phospho T180/Y182 (1)
- Phospho T202/Y204 + T185/Y187 (1)
- Phospho T389 (1)
- Phospho T395 (1)
- Phospho T45 (1)
- Phospho T498 (1)
- Phospho T6 (1)
- Phospho T91 (1)
- Phospho Y1022/1023 (1)
- Phospho Y15 (1)
- Phospho Y705 (1)
- This chimeric human antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric mouse antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric murine antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgM format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG3 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse scFv antibody fragment format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG2b format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. (1)
- This constant region of this antibody has been modified to bind to Protein A, allowing highly-specific purification of this antibody by Protein A-affinity column. (1)
- This full-length, chimeric rabbit antibody was made using the variable domain sequences of the original Mouse scFv format, for improved compatibility with existing reagents, assays and techniques. (1)
- This full-length, reformatted mouse antibody was made using the variable domain sequences of the original Mouse scFv format, for improved compatibility with existing reagents, assays and techniques. (1)
- This reformatted mouse antibody was made using the variable domain sequences of the original Mouse scFv antibody fragment format, for improved compatibility with existing reagents, assays and techniques. (1)
- Unconjugated (1)
- citrulline R2/R8/R17 (1)
Assay Types
Families
- Druggable Genome (12445)
- Transmembrane (4157)
- Transcription Factors (2789)
- Protein Kinase (1804)
- ES Cell Differentiation/IPS (1631)
- Secreted Protein (1481)
- Stem cell - Pluripotency (790)
- Protease (747)
- Adult stem cells (302)
- GPCR (227)
- Phosphatase (226)
- Embryonic stem cells (192)
- P450 (185)
- Stem cell relevant signaling - JAK/STAT signaling pathway (135)
- Ion Channels: Other (127)
- Cancer stem cells (117)
- Induced pluripotent stem cells (115)
- Stem cell relevant signaling - DSL/Notch pathway (108)
- Nuclear Hormone Receptor (105)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (62)
- Ion Channels: Potassium (44)
- Stem cell relevant signaling - Wnt Signaling pathway (26)
- Ion Channels: Transient receptor potential (16)
- Ion Channels: Glutamate Receptors (9)
- Ion Channels: ATP Receptors (4)
- Ion Channels: Cyclic nucleotide gated (4)
- Ion Channels: Cys-loop Receptors (3)
- Ion Channels: Calcium (2)
- Ion Channels: Sodium (1)
Pathways
- Metabolic pathways (2432)
- Pathways in cancer (1679)
- MAPK signaling pathway (1301)
- Neurotrophin signaling pathway (936)
- Focal adhesion (929)
- Prostate cancer (897)
- Toll-like receptor signaling pathway (875)
- Pancreatic cancer (853)
- Progesterone-mediated oocyte maturation (837)
- Chronic myeloid leukemia (821)
- T cell receptor signaling pathway (813)
- Fc epsilon RI signaling pathway (811)
- Non-small cell lung cancer (804)
- Insulin signaling pathway (784)
- Colorectal cancer (781)
- Melanoma (773)
- Endometrial cancer (764)
- ErbB signaling pathway (763)
- Regulation of actin cytoskeleton (747)
- Glioma (733)
- Bladder cancer (715)
- GnRH signaling pathway (673)
- B cell receptor signaling pathway (648)
- Fc gamma R-mediated phagocytosis (623)
- Acute myeloid leukemia (609)
- Chemokine signaling pathway (596)
- Renal cell carcinoma (586)
- Cell cycle (581)
- VEGF signaling pathway (577)
- Gap junction (566)
- Cell adhesion molecules (CAMs) (546)
- Apoptosis (536)
- Thyroid cancer (514)
- Natural killer cell mediated cytotoxicity (506)
- Leukocyte transendothelial migration (486)
- p53 signaling pathway (466)
- Oocyte meiosis (463)
- Amyotrophic lateral sclerosis (ALS) (445)
- Small cell lung cancer (430)
- Jak-STAT signaling pathway (421)
- Purine metabolism (417)
- Alzheimer's disease (401)
- Huntington's disease (399)
- Endocytosis (391)
- Wnt signaling pathway (388)
- Melanogenesis (377)
- Vascular smooth muscle contraction (356)
- Hematopoietic cell lineage (346)
- Prion diseases (336)
- Adherens junction (333)
- Long-term potentiation (331)
- Axon guidance (329)
- Long-term depression (328)
- Ubiquitin mediated proteolysis (323)
- Type II diabetes mellitus (305)
- Parkinson's disease (297)
- Cytokine-cytokine receptor interaction (295)
- Tight junction (292)
- Adipocytokine signaling pathway (284)
- mTOR signaling pathway (283)
- Pathogenic Escherichia coli infection (279)
- Glycolysis / Gluconeogenesis (271)
- Epithelial cell signaling in Helicobacter pylori infection (266)
- Dorso-ventral axis formation (255)
- Pyrimidine metabolism (249)
- Valine (243)
- NOD-like receptor signaling pathway (242)
- Primary immunodeficiency (237)
- RIG-I-like receptor signaling pathway (237)
- Systemic lupus erythematosus (228)
- leucine and isoleucine degradation (228)
- Calcium signaling pathway (225)
- Basal cell carcinoma (221)
- Neuroactive ligand-receptor interaction (216)
- Nucleotide excision repair (201)
- Glycerolipid metabolism (195)
- TGF-beta signaling pathway (194)
- Arginine and proline metabolism (192)
- Oxidative phosphorylation (191)
- Tryptophan metabolism (183)
- Tyrosine metabolism (175)
- Antigen processing and presentation (157)
- Pyruvate metabolism (156)
- Drug metabolism - cytochrome P450 (155)
- Proteasome (148)
- Metabolism of xenobiotics by cytochrome P450 (147)
- Arachidonic acid metabolism (142)
- Fatty acid metabolism (141)
- Viral myocarditis (141)
- Propanoate metabolism (131)
- beta-Alanine metabolism (131)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (130)
- Type I diabetes mellitus (126)
- Butanoate metabolism (121)
- PPAR signaling pathway (120)
- Glutathione metabolism (118)
- Citrate cycle (TCA cycle) (117)
- Inositol phosphate metabolism (117)
- Graft-versus-host disease (116)
- Phosphatidylinositol signaling system (115)
- Regulation of autophagy (115)
- Cytosolic DNA-sensing pathway (114)
- Fructose and mannose metabolism (113)
- Glycine (111)
- Olfactory transduction (111)
- serine and threonine metabolism (111)
- Maturity onset diabetes of the young (107)
- Retinol metabolism (106)
- Cysteine and methionine metabolism (102)
- Base excision repair (96)
- Lysine degradation (95)
- Hypertrophic cardiomyopathy (HCM) (92)
- Vibrio cholerae infection (92)
- Pentose phosphate pathway (91)
- Linoleic acid metabolism (88)
- Terpenoid backbone biosynthesis (88)
- Amino sugar and nucleotide sugar metabolism (87)
- Notch signaling pathway (86)
- Lysosome (84)
- Dilated cardiomyopathy (83)
- Spliceosome (81)
- RNA degradation (77)
- Complement and coagulation cascades (76)
- Synthesis and degradation of ketone bodies (72)
- Allograft rejection (71)
- Cardiac muscle contraction (71)
- Autoimmune thyroid disease (69)
- Hedgehog signaling pathway (68)
- Mismatch repair (66)
- Ascorbate and aldarate metabolism (63)
- DNA replication (62)
- Non-homologous end-joining (60)
- Galactose metabolism (58)
- One carbon pool by folate (58)
- Histidine metabolism (56)
- ECM-receptor interaction (55)
- Caffeine metabolism (54)
- Homologous recombination (54)
- SNARE interactions in vesicular transport (53)
- RNA polymerase (51)
- Starch and sucrose metabolism (51)
- Drug metabolism - other enzymes (50)
- N-Glycan biosynthesis (45)
- Alanine (44)
- aspartate and glutamate metabolism (44)
- Nicotinate and nicotinamide metabolism (43)
- Folate biosynthesis (41)
- Fatty acid elongation in mitochondria (40)
- Renin-angiotensin system (40)
- Sphingolipid metabolism (38)
- Glycosaminoglycan degradation (33)
- Porphyrin and chlorophyll metabolism (32)
- Biosynthesis of unsaturated fatty acids (30)
- Other glycan degradation (30)
- Nitrogen metabolism (28)
- Glyoxylate and dicarboxylate metabolism (27)
- Sulfur metabolism (26)
- Basal transcription factors (23)
- Circadian rhythm - mammal (23)
- Pantothenate and CoA biosynthesis (22)
- Glycerophospholipid metabolism (21)
- Primary bile acid biosynthesis (21)
- Selenoamino acid metabolism (20)
- Androgen and estrogen metabolism (19)
- Asthma (18)
- Glycosphingolipid biosynthesis - lacto and neolacto series (17)
- Keratan sulfate biosynthesis (17)
- Methane metabolism (17)
- Ribosome (17)
- Glycosphingolipid biosynthesis - ganglio series (16)
- Vitamin B6 metabolism (16)
- leucine and isoleucine biosynthesis (15)
- Taurine and hypotaurine metabolism (13)
- Fatty acid biosynthesis (12)
- Phenylalanine metabolism (12)
- Aminoacyl-tRNA biosynthesis (10)
- Steroid biosynthesis (10)
- Taste transduction (10)
- Limonene and pinene degradation (9)
- ABC transporters (7)
- O-Glycan biosynthesis (7)
- Pentose and glucuronate interconversions (6)
- Heparan sulfate biosynthesis (5)
- C21-Steroid hormone metabolism (4)
- Chondroitin sulfate biosynthesis (3)
- D-Glutamine and D-glutamate metabolism (3)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (2)
- Ether lipid metabolism (1)
- Glycosphingolipid biosynthesis - globo series (1)
- Riboflavin metabolism (1)