Germany
Japan
United Kingdom
China
Antibodies
Download
USD 428.00
In Stock
USD 428.00
In Stock
Rabbit Polyclonal Anti-E2F6 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human E2F6 |
TA349302 is a possible alternative to TA324290.
Rabbit Polyclonal Anti-PHB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PHB |
TA349430 is a possible alternative to TA322982.
Rabbit Polyclonal Anti-HNRPD Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPD antibody: synthetic peptide directed towards the C terminal of human HNRPD. Synthetic peptide located within the following region: YGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKP |
Rabbit polyclonal IRF-3 (Ser385) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IRF-3 around the phosphorylation site of serine 385 (G-A-SP-S-L). |
| Modifications | Phospho-specific |
Rabbit anti-STAT3 (Phospho-Tyr705) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT3 around the phosphorylation site of tyrosine 705 (A-P-YP-L-K). |
| Modifications | Phospho-specific |
Rabbit polyclonal GR (Ab-211) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human GR around the phosphorylation site of serine 211 (N-E-S-P-W). |
Rabbit polyclonal MITF (Ab-180/73) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human MITF around the phosphorylation site of serine 180/73 (P-N-SP-P-M). |
Rabbit polyclonal antibody to MCM7 (minichromosome maintenance complex component 7)
| Applications | Assay, IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 190 and 481 of MCM7 (Uniprot ID#P33993) |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- IHC
Families
- Transcription Factors
Availabilities
- In Stock
Filter by
Target Symbol
- TP53 (48)
- PGR (40)
- MAP2K3 (38)
- NKX3-1 (30)
- JUN (29)
- CTNNB1 (28)
- MDM4 (24)
- MCM2 (22)
- ESR1 (21)
- ERG (20)
- GLI1 (20)
- MDM2 (20)
- MEF2C (20)
- TLE1 (20)
- NR3C1 (19)
- TSC22D1 (18)
- FOS (17)
- BHLHE41 (16)
- SLA2 (16)
- ZSCAN18 (16)
- CBX8 (14)
- NKX2-1 (14)
- PARN (14)
- TP53BP1 (14)
- CD80 (13)
- CLOCK (13)
- SKIL (13)
- STAT4 (13)
- AR (12)
- FOXI1 (12)
- FOXP1 (12)
- NR2C2 (12)
- PAX5 (12)
- SQSTM1 (12)
- TRIB3 (12)
- ATF1 (11)
- GATA3 (11)
- HDAC9 (11)
- MED15 (11)
- NEUROG1 (11)
- NR1I3 (11)
- PPP5C (11)
- PRRX1 (11)
- APEX1 (10)
- CDX2 (10)
- HES1 (10)
- ID3 (10)
- NONO (10)
- POGK (10)
- SMAD1 (10)
- TCF12 (10)
- ELL (9)
- IRF3 (9)
- MEIS1 (9)
- NR4A3 (9)
- SNAI2 (9)
- STAT5A (9)
- TP73 (9)
- ZEB1 (9)
- HDAC6 (8)
- HMG20A (8)
- ID2 (8)
- MYC (8)
- PHF20L1 (8)
- RB1 (8)
- SATB1 (8)
- SP110 (8)
- SSB (8)
- TNF (8)
- ZNF217 (8)
- ZNF69 (8)
- ARNT (7)
- ARNTL (7)
- BCL6 (7)
- BRCA1 (7)
- CNOT2 (7)
- EZH2 (7)
- LHX1 (7)
- MAFB (7)
- MEF2D (7)
- NR0B2 (7)
- PDX1 (7)
- RFXANK (7)
- ZEB2 (7)
- ASH2L (6)
- CRABP2 (6)
- ERCC8 (6)
- GAS7 (6)
- HDAC2 (6)
- HSF2 (6)
- MEOX1 (6)
- MORF4 (6)
- NAB1 (6)
- NAB2 (6)
- NR5A1 (6)
- NSD3 (6)
- PHF7 (6)
- PPP1R8 (6)
- TET3 (6)
- YBX1 (6)
Reactivities
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (321)
- MAPK signaling pathway (226)
- Prostate cancer (175)
- Wnt signaling pathway (145)
- Cell cycle (143)
- Colorectal cancer (134)
- Toll-like receptor signaling pathway (132)
- Chronic myeloid leukemia (124)
- Neurotrophin signaling pathway (110)
- p53 signaling pathway (106)
- Basal cell carcinoma (99)
- Amyotrophic lateral sclerosis (ALS) (96)
- Endometrial cancer (93)
- Thyroid cancer (90)
- Bladder cancer (87)
- Small cell lung cancer (87)
- Pancreatic cancer (79)
- Melanoma (78)
- Glioma (77)
- T cell receptor signaling pathway (76)
- Apoptosis (72)
- GnRH signaling pathway (72)
- Huntington's disease (72)
- B cell receptor signaling pathway (66)
- Non-small cell lung cancer (64)
- TGF-beta signaling pathway (64)
- Oocyte meiosis (61)
- Focal adhesion (60)
- ErbB signaling pathway (56)
- Ubiquitin mediated proteolysis (56)
- Jak-STAT signaling pathway (51)
- Acute myeloid leukemia (50)
- Renal cell carcinoma (48)
- Fc epsilon RI signaling pathway (46)
- Adherens junction (43)
- Epithelial cell signaling in Helicobacter pylori infection (40)
- Progesterone-mediated oocyte maturation (40)
- Circadian rhythm - mammal (38)
- Melanogenesis (36)
- Adipocytokine signaling pathway (35)
- Tight junction (35)
- Maturity onset diabetes of the young (33)
- DNA replication (32)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (30)
- Chemokine signaling pathway (30)
- Endocytosis (30)
- RIG-I-like receptor signaling pathway (30)
- Pathogenic Escherichia coli infection (29)
- Systemic lupus erythematosus (29)
- Leukocyte transendothelial migration (28)
- RNA degradation (27)
- Cytosolic DNA-sensing pathway (25)
- Allograft rejection (24)
- Graft-versus-host disease (24)
- Neuroactive ligand-receptor interaction (24)
- Notch signaling pathway (24)
- Type I diabetes mellitus (24)
- Hedgehog signaling pathway (21)
- NOD-like receptor signaling pathway (19)
- Metabolic pathways (18)
- Viral myocarditis (18)
- Base excision repair (17)
- Autoimmune thyroid disease (16)
- Cell adhesion molecules (CAMs) (16)
- Type II diabetes mellitus (16)
- Insulin signaling pathway (15)
- Antigen processing and presentation (14)
- Natural killer cell mediated cytotoxicity (13)
- Nucleotide excision repair (12)
- Cytokine-cytokine receptor interaction (11)
- PPAR signaling pathway (11)
- Primary immunodeficiency (11)
- Alzheimer's disease (10)
- Basal transcription factors (10)
- Dilated cardiomyopathy (9)
- Hypertrophic cardiomyopathy (HCM) (9)
- Asthma (8)
- Hematopoietic cell lineage (8)
- Purine metabolism (7)
- Pyrimidine metabolism (7)
- Axon guidance (6)
- Dorso-ventral axis formation (6)
- Lysine degradation (6)
- RNA polymerase (6)
- mTOR signaling pathway (6)
- Long-term potentiation (5)
- VEGF signaling pathway (5)
- Cysteine and methionine metabolism (4)
- Non-homologous end-joining (4)
- Long-term depression (3)
- Proteasome (3)
- Ribosome (3)
- Fc gamma R-mediated phagocytosis (2)
- Glycolysis / Gluconeogenesis (2)
- Prion diseases (2)
- Valine (2)
- Vascular smooth muscle contraction (2)
- leucine and isoleucine degradation (2)
- Biosynthesis of unsaturated fatty acids (1)
- Calcium signaling pathway (1)
- Glycerolipid metabolism (1)
- Glycine (1)
- Glyoxylate and dicarboxylate metabolism (1)
- Homologous recombination (1)
- Regulation of actin cytoskeleton (1)
- Spliceosome (1)
- serine and threonine metabolism (1)