Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Anti-PDGFB Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDGFB antibody: synthetic peptide directed towards the N terminal of human PDGFB. Synthetic peptide located within the following region: NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD |
Rabbit Polyclonal Antibody against PIK3CA (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KCA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 504-533 amino acids from the Central region of human PI3KCA. |
Rabbit polyclonal IGF1R (Tyr1346) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IGF1R around the phosphorylation site of tyrosine 1346 (Q-P-YP-A-H). |
| Modifications | Phospho-specific |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
PDGF Receptor alpha (PDGFRA) (1035-1053) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide KLH-conjugated corresponding to amino acids 1000 to the C-term of Human PDGF |
Rabbit Polyclonal Antibody against BRAF (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This B-RAF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 424-453 amino acids from the Central region of human B-RAF. |
Rabbit anti-BAD (Phospho-Ser112) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanBAD around the phosphorylation site of serine 112 (H-S-SP-Y-P). |
| Modifications | Phospho-specific |
Rabbit anti-MTOR polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized non-phosphopeptide derived fromhuman mTOR around the phosphorylation site of serine 2448 (T-D-SP-Y-S). |
Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C). |
| Modifications | Phospho-specific |
Rabbit polyclonal Androgen Receptor (Ab-650) antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Androgen Receptor around the phosphorylation site of serine 650 (T-T-SP-P-T). |
Rabbit Polyclonal CREB (Ser133) Antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human CREB around the phosphorylation site of Sersine 133. |
| Modifications | Phospho-specific |
Rabbit anti-PDGFRB Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PDGFRB |
Rabbit Polyclonal Anti-SRD5A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SRD5A2 antibody: synthetic peptide directed towards the N terminal of human SRD5A2. Synthetic peptide located within the following region: MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR |
Active filters
Category
- Antibodies
Applications
- IHC
Clonalities
- Polyclonal
Pathways
- Prostate cancer
Filter by
Target Symbol
- AKT1 (29)
- EGFR (23)
- RELA (22)
- TP53 (22)
- BAD (16)
- FOXO1 (15)
- CASP9 (14)
- CTNNB1 (14)
- CREB1 (13)
- MAP2K1 (13)
- CHUK (12)
- EGF (11)
- ERBB2 (11)
- NFKBIA (11)
- PDGFRB (11)
- BRAF (10)
- HSP90B1 (10)
- MTOR (10)
- RAF1 (10)
- BCL2 (9)
- PIK3R1 (9)
- GSK3B (8)
- HSP90AB1 (8)
- IKBKG (8)
- NFKB1 (8)
- AKT2 (7)
- FGFR1 (7)
- PDGFB (7)
- AKT3 (6)
- AR (6)
- CCNE1 (6)
- CDKN1B (6)
- FGFR2 (6)
- GRB2 (6)
- GSTP1 (6)
- HSP90AA1 (6)
- IGF1 (6)
- MDM2 (6)
- PDGFA (6)
- PTEN (6)
- RB1 (6)
- CREBBP (5)
- EP300 (5)
- IGF1R (5)
- INS (5)
- ATF4 (4)
- CCND1 (4)
- CDKN1A (4)
- IKBKB (4)
- MAP2K2 (4)
- MAPK1 (4)
- PDPK1 (4)
- PIK3CG (4)
- CCNE2 (3)
- E2F1 (3)
- KLK3 (3)
- MAPK3 (3)
- NRAS (3)
- PDGFRA (3)
- PIK3CA (3)
- PIK3CD (3)
- TGFA (3)
- CDK2 (2)
- CREB3L1 (2)
- E2F2 (2)
- HRAS (2)
- LEF1 (2)
- NKX3-1 (2)
- PIK3R3 (2)
- PIK3R5 (2)
- TCF7 (2)
- ARAF (1)
- CREB3L2 (1)
- CREB3L4 (1)
- E2F3 (1)
- PDGFC (1)
- PIK3CB (1)
- PIK3R2 (1)
- SRD5A2 (1)
- TCF7L1 (1)
Reactivities
Antibody Hosts
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (524)
- Protein Kinase (193)
- Transcription Factors (156)
- ES Cell Differentiation/IPS (136)
- Transmembrane (90)
- Stem cell - Pluripotency (63)
- Secreted Protein (46)
- Adult stem cells (37)
- Stem cell relevant signaling - JAK/STAT signaling pathway (27)
- Cancer stem cells (23)
- Protease (17)
- Embryonic stem cells (12)
- Induced pluripotent stem cells (12)
- Stem cell relevant signaling - DSL/Notch pathway (10)
- Nuclear Hormone Receptor (6)
- Phosphatase (6)
- Stem cell relevant signaling - Wnt Signaling pathway (4)