Rabbit Monoclonal antibody against Gli-1 (GLI1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Monoclonal antibody against Gli-1 (GLI1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
PAX3 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PAX3 |
Rabbit Polyclonal Anti-BDNF Antibody
Applications | IHC, WB |
Reactivities | Human, Macaque, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Rabbit Polyclonal Anti-GRB7 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GRB7 |
Anti-POU5F1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 1-150 amino acids of human POU class 5 homeobox 1 |
Goat Polyclonal Anti-BDNF Antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-BDNF Antibody: Peptide with sequence ETKCNPMGYTKE, from the internal region of the protein sequence according to NP_001700.2; NP_001700.2; NP_733928.1; NP_733929.1; NP_733930.1; NP_733931.1. |
Rabbit Polyclonal Anti-CDX2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CDX2 antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of human CDX2. |
Rabbit anti-BDNF Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BDNF |
Rabbit anti-CD44 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human CD44 |
Rabbit anti-CD9 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CD9 |
Rabbit monoclonal antibody against HNF 3 Beta(clone EPR4466)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against SOX2 - Embryonic Stem Cell Marker
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Sheep |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the N-terminal region of human SOX2 protein (within residues 1-100). [Swiss-Prot# P48431] |
Rabbit polyclonal KLF5 Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This KLF5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 341-370 amino acids from the C-terminal region of human KLF5. |
Rabbit polyclonal SMAD3-S208 Antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3. |
Anti-Human EGF Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived recombinant Human EGF |
Rabbit Polyclonal Anti-HBZ Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HBZ antibody: synthetic peptide directed towards the N terminal of human HBZ. Synthetic peptide located within the following region: ERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGA |
Rabbit Polyclonal Anti-OTX2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-OTX2 antibody: synthetic peptide directed towards the N terminal of human OTX2. Synthetic peptide located within the following region: PESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGT |
Rabbit polyclonal anti-DNMT3B antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human DNMT3B. |
Rabbit polyclonal anti-Gli-3 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Chimpanzee, Squirrel Monkey, Xenopus, Chicken, Dog |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was produced from monospecific rabbit serum by repeated immunizations with a synthetic peptide corresponding to amino acids 41-57 of human Gli-3 protein. |
Rabbit polyclonal NeuroD1 Antibody (N-term)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This NeuroD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 15-45 amino acids from the N-terminal region of human NeuroD1. |
Rabbit polyclonal KLF4 Antibody (N-term C74)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This KLF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 69-101 amino acids from the N-terminal region of human KLF4. |
DNMT3B (1-50) rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide from Human DNMT3B (aa 1-50) |
Rabbit Polyclonal KLF4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | KLF4 antibody was raised against a 20 amino acid peptide near the carboxy terminus of human KLF4. |
Rabbit polyclonal SOX-9 (Ser181) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human SOX-9 around the phosphorylation site of serine 181 (R-K-SP-V-K). |
Modifications | Phospho-specific |
Anti-GDF3 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 251-364 amino acids of human growth differentiation factor 3 |
SOX9 rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide - KLH conjugated |
SOX2 (N-term) rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal NANOG Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | NANOG antibody was raised against a 19 amino acid peptide near the center of human NANOG. |
Rabbit polyclonal SMAD3 phospho S423/phospho S425 antibody
Applications | IHC, WB |
Reactivities | Human, Zebrafish, Rat, Mouse, Swine, Bovine, Chicken |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 417-425 of human SMAD3 protein. |
Anti-SMAD3 (Phospho-Ser425) Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of serine 425 (C-S-S-V-S(p)) derived from Human Smad3. |
Modifications | Phospho-specific |
Rabbit polyclonal PAX3 Antibody (N-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This PAX3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 98-126 amino acids from the N-terminal region of human PAX3. |
Rabbit polyclonal IGFBP2 Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This IGFBP2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 277-305 amino acids from the C-terminal region of human IGFBP2. |
Rabbit polyclonal OCT3 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human OCT3 antibody. |
Rabbit polyclonal MYC antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human Myc. |
Anti-Human BMP-7 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | CHO cells derived Recombinant Human BMP-7 |
Rabbit Polyclonal anti-GLI2 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GLI2 antibody: synthetic peptide directed towards the N terminal of human GLI2. Synthetic peptide located within the following region: RNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCLHVRAIKTE |
Rabbit Polyclonal Anti-PROX1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PROX1 |
NEUROD1 (201-300) mouse monoclonal antibody, clone 3D11, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
c Kit (KIT) mouse monoclonal antibody, clone 4F7, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Goat Polyclonal Antibody against FOXA2
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-GVYSRPIMNSS, from the C Terminus of the protein sequence according to NP_068556.1; NP_710141.1. |
Rabbit Polyclonal antibody to CD44 (CD44 molecule (Indian blood group))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 258 of CD44 |
Rabbit polyclonal Smad3 (Ab-204) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Smad3 around the phosphorylation site of serine 204 (A-G-SP-P-N). |
Rabbit polyclonal FOXA2 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This FOXA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 128-157 amino acids from the Central region of human FOXA2. |
Rabbit polyclonal FOXA2 Antibody (C-term)
Applications | IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | This FOXA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 380-407 amino acids from the C-terminal region of human FOXA2. |
Rabbit polyclonal KLF4 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This KLF4 antibody is generated from rabbits immunized with a his tag recombinant protein of human KLF4. |
Rabbit Polyclonal C-myc antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human C-myc |
Anti-Human GDF-3 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human GDF-3 |
Anti-Human KGF Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human KGF (FGF-7) |
Rabbit Polyclonal anti-GATA6 antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GATA6 antibody: synthetic peptide directed towards the middle region of human GATA6. Synthetic peptide located within the following region: SGAGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDS |
Rabbit Polyclonal Anti-PAX3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PAX3 antibody: synthetic peptide directed towards the C terminal of human PAX3. Synthetic peptide located within the following region: GGVPHQPQTDYALSPLTGGLEPTTTVSASCSQRLDHMKSLDSLPTSQSYC |