Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-CDC25B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC25B antibody: synthetic peptide directed towards the N terminal of human CDC25B. Synthetic peptide located within the following region: TQTMHDLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSE |
Prostatic Acid Phosphatase (ACPP) rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IHC, IP, R, WB |
| Reactivities | Human |
| Immunogen | Acid Phosphatase isolated and purified from Human seminal plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit Polyclonal Anti-ACP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACP1 antibody: synthetic peptide directed towards the N terminal of human ACP1. Synthetic peptide located within the following region: PIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIP |
Rabbit Polyclonal Anti-CTDSPL Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTDSPL antibody: synthetic peptide directed towards the N terminal of human CTDSPL. Synthetic peptide located within the following region: CCFRDYNVEAPPPSSPSVLPPLVEENGGLQKPPAKYLLPEVTVLDYGKKC |
USD 524.00
In Stock
Rabbit Polyclonal antibody to PP1C gamma (protein phosphatase 1, catalytic subunit, gamma isozyme)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 2 and 227 of PP1C gamma (Uniprot ID#P36873) |
CDC25A Rabbit Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CDC25A |
Rabbit anti-PPP1CA Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PPP1CA |
Rabbit polyclonal antibody to myotubularin related protein 4 (myotubularin related protein 4)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 281 and 578 of myotubularin related protein 4 (Uniprot ID#Q9NYA4) |
Anti-PTEN (Phospho-Ser380/Thr382/Thr383) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of threonine 380/382/383 (R-Y-S(p)-D-T(p)-T(p)-D-S) derived from Human PTEN. |
| Modifications | Phospho-specific |
Rabbit polyclonal SSH3 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SSH3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 575-602 amino acids from the C-terminal region of human SSH3. |
Rabbit polyclonal PTP4A2 Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PTP4A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 32-59 amino acids from the Central region of human PTP4A2. |
Rabbit polyclonal Anti-SET Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SET antibody: synthetic peptide directed towards the N terminal of human SET. Synthetic peptide located within the following region: IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT |
Goat Polyclonal Antibody against DUSP16
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence AHEMIGTQIVTER-C, from the N Terminus of the protein sequence according to NP_085143.1. |
Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298) |
Rabbit polyclonal CDC25C (Ser198) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CDC25C around the phosphorylation site of serine 198 (E-F-SP-L-K). |
| Modifications | Phospho-specific |
PPP2R1A rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | A peptide conjugated to KLH |
PPP2R1A sheep polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | A peptide conjugated to KLH corresponding to amino acids 7-19 sequence (N-terminal) of PP2A/A regulatory subunit having a MW of 65kD |
PPP2R1B rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | A peptide conjugated to KLH |
PPP2R1B sheep polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | The immunogen used to the purified peptide conjugated to KLH corresponding to the sequence NH2-Phe-Ser-Gln-Val-Lys-Gly-Ala-Val-Asp-Asp-Asp-Val-Ala-Glu-COOH. This peptide antibody corresponds to N -terminal peptide of PP2A/B a regulatory subunit having a MW of 55kD. |
Active filters
Filter by
Target Symbol
- PTEN (8)
- CDC25A (6)
- PPP1CB (4)
- PPP4C (4)
- PTPN11 (4)
- CDC25B (3)
- CDC25C (3)
- DUSP1 (3)
- DUSP26 (3)
- DUSP6 (3)
- PPP2R1B (3)
- PPP3CA (3)
- PTP4A2 (3)
- PTPRJ (3)
- PTPRM (3)
- DUSP12 (2)
- DUSP16 (2)
- DUSP4 (2)
- DUSP8 (2)
- MTMR4 (2)
- PPP1CC (2)
- PPP2CA (2)
- PPP2CB (2)
- PPP2R1A (2)
- PTPN13 (2)
- PTPRC (2)
- PTPRE (2)
- PTPRK (2)
- SET (2)
- SSH3 (2)
- ACP1 (1)
- ACPP (1)
- CDKN3 (1)
- CTDSP1 (1)
- CTDSPL (1)
- DUSP10 (1)
- DUSP11 (1)
- DUSP13 (1)
- DUSP14 (1)
- DUSP19 (1)
- DUSP2 (1)
- DUSP22 (1)
- DUSP23 (1)
- DUSP3 (1)
- DUSP7 (1)
- EYA3 (1)
- ILKAP (1)
- MTMR2 (1)
- MTMR7 (1)
- MTMR9 (1)
- PDP1 (1)
- PPFIA1 (1)
- PPM1F (1)
- PPM1K (1)
- PPP1CA (1)
- PPP1R1C (1)
- PPP2R2A (1)
- PPP2R3A (1)
- PPP3CB (1)
- PPP6C (1)
- PTPN1 (1)
- PTPN12 (1)
- PTPN20 (1)
- PTPN22 (1)
- PTPN3 (1)
- PTPN4 (1)
- PTPN5 (1)
- PTPN6 (1)
- PTPN7 (1)
- PTPRA (1)
- PTPRR (1)
- SIRPA (1)
Reactivities
Antibody Hosts
Clonalities
Conjugates
Modifications
Pathways
- MAPK signaling pathway (27)
- Oocyte meiosis (23)
- Tight junction (18)
- Focal adhesion (15)
- Wnt signaling pathway (13)
- Cell cycle (12)
- Progesterone-mediated oocyte maturation (12)
- Long-term potentiation (11)
- Adherens junction (9)
- Long-term depression (9)
- Natural killer cell mediated cytotoxicity (9)
- Regulation of actin cytoskeleton (9)
- TGF-beta signaling pathway (9)
- Endometrial cancer (8)
- Glioma (8)
- Inositol phosphate metabolism (8)
- Insulin signaling pathway (8)
- Melanoma (8)
- Pathways in cancer (8)
- Phosphatidylinositol signaling system (8)
- Prostate cancer (8)
- Small cell lung cancer (8)
- p53 signaling pathway (8)
- T cell receptor signaling pathway (7)
- Vascular smooth muscle contraction (7)
- B cell receptor signaling pathway (5)
- Cell adhesion molecules (CAMs) (5)
- Jak-STAT signaling pathway (5)
- Adipocytokine signaling pathway (4)
- Alzheimer's disease (4)
- Amyotrophic lateral sclerosis (ALS) (4)
- Apoptosis (4)
- Axon guidance (4)
- Calcium signaling pathway (4)
- Chronic myeloid leukemia (4)
- Epithelial cell signaling in Helicobacter pylori infection (4)
- Leukocyte transendothelial migration (4)
- Neurotrophin signaling pathway (4)
- Renal cell carcinoma (4)
- Riboflavin metabolism (4)
- VEGF signaling pathway (4)
- Fc gamma R-mediated phagocytosis (2)
- Fructose and mannose metabolism (2)
- Metabolic pathways (2)
- Primary immunodeficiency (2)
- Thiamine metabolism (2)