Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-CDC25B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC25B antibody: synthetic peptide directed towards the N terminal of human CDC25B. Synthetic peptide located within the following region: TQTMHDLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSE |
Rabbit Polyclonal Anti-ACP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACP1 antibody: synthetic peptide directed towards the N terminal of human ACP1. Synthetic peptide located within the following region: PIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIP |
Rabbit Polyclonal Anti-CTDSPL Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTDSPL antibody: synthetic peptide directed towards the N terminal of human CTDSPL. Synthetic peptide located within the following region: CCFRDYNVEAPPPSSPSVLPPLVEENGGLQKPPAKYLLPEVTVLDYGKKC |
USD 524.00
In Stock
Rabbit Polyclonal antibody to PP1C gamma (protein phosphatase 1, catalytic subunit, gamma isozyme)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 2 and 227 of PP1C gamma (Uniprot ID#P36873) |
CDC25A Rabbit Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CDC25A |
Rabbit anti-PPP1CA Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PPP1CA |
SHP1 (PTPN6) mouse monoclonal antibody, clone PTY11, Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
SHP1 (PTPN6) mouse monoclonal antibody, clone PTY15, Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Anti-Human PTPN6 / SHP-1 Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-PTEN (Phospho-Ser380/Thr382/Thr383) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of threonine 380/382/383 (R-Y-S(p)-D-T(p)-T(p)-D-S) derived from Human PTEN. |
| Modifications | Phospho-specific |
Rabbit polyclonal SSH3 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SSH3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 575-602 amino acids from the C-terminal region of human SSH3. |
Rabbit polyclonal PTP4A2 Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PTP4A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 32-59 amino acids from the Central region of human PTP4A2. |
Rabbit polyclonal Anti-SET Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SET antibody: synthetic peptide directed towards the N terminal of human SET. Synthetic peptide located within the following region: IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT |
Goat Polyclonal Antibody against DUSP16
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence AHEMIGTQIVTER-C, from the N Terminus of the protein sequence according to NP_085143.1. |
Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298) |
Rabbit polyclonal CDC25C (Ser198) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CDC25C around the phosphorylation site of serine 198 (E-F-SP-L-K). |
| Modifications | Phospho-specific |
Mouse Monoclonal PPP1A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Monoclonal Protein Phosphatase 4C Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against CTDSP1 (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CTDSP1-V250 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 235-261 amino acids from the C-terminal region of human CTDSP1-V250. |
Rabbit Polyclonal Antibody against PPM1F (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PPM1F antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 11-40 amino acids from the N-terminal region of human PPM1F. |
Active filters
Category
- Antibodies
Reactivities
- Human
Applications
- IHC
Families
- Phosphatase
Filter by
Target Symbol
- PTPRC (63)
- PTPRE (47)
- PPP4C (18)
- CTDSP1 (17)
- PTPN1 (16)
- CDKN3 (11)
- PTPN7 (11)
- CTDSP2 (10)
- PPP2R5D (10)
- PTEN (8)
- PPP1CA (7)
- DUSP10 (6)
- DUSP23 (6)
- PPP2R1B (6)
- PPP3CA (6)
- PTPN22 (6)
- SIRPA (6)
- CDC25A (5)
- DAPP1 (5)
- DUSP29 (5)
- PPM1B (5)
- PPP1R7 (5)
- PPP4R4 (5)
- PPP1CB (4)
- PTPN6 (4)
- CDC25B (3)
- CDC25C (3)
- DUSP1 (3)
- DUSP6 (3)
- PTP4A2 (3)
- PTPN11 (3)
- PTPRJ (3)
- PTPRM (3)
- DUSP12 (2)
- DUSP16 (2)
- DUSP22 (2)
- DUSP4 (2)
- DUSP8 (2)
- PPM1F (2)
- PPP1CC (2)
- PPP2CB (2)
- PTPN13 (2)
- PTPRK (2)
- SET (2)
- SSH3 (2)
- ACP1 (1)
- ACPP (1)
- CTDSPL (1)
- DUSP11 (1)
- DUSP13 (1)
- DUSP14 (1)
- DUSP19 (1)
- DUSP2 (1)
- DUSP26 (1)
- DUSP3 (1)
- DUSP7 (1)
- EYA1 (1)
- EYA3 (1)
- ILKAP (1)
- MTMR4 (1)
- MTMR7 (1)
- MTMR9 (1)
- PDP1 (1)
- PPFIA1 (1)
- PPM1K (1)
- PPP1R1C (1)
- PPP2CA (1)
- PPP2R1A (1)
- PPP2R2A (1)
- PPP2R3A (1)
- PPP3CB (1)
- PTPN12 (1)
- PTPN2 (1)
- PTPN20 (1)
- PTPN3 (1)
- PTPN4 (1)
- PTPN5 (1)
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- T cell receptor signaling pathway (74)
- Cell adhesion molecules (CAMs) (66)
- Fc gamma R-mediated phagocytosis (63)
- Primary immunodeficiency (63)
- MAPK signaling pathway (49)
- Oocyte meiosis (43)
- Insulin signaling pathway (29)
- Adherens junction (27)
- Wnt signaling pathway (27)
- Focal adhesion (21)
- Long-term potentiation (20)
- Tight junction (19)
- B cell receptor signaling pathway (16)
- Regulation of actin cytoskeleton (15)
- Natural killer cell mediated cytotoxicity (14)
- Vascular smooth muscle contraction (13)
- Cell cycle (11)
- Progesterone-mediated oocyte maturation (11)
- Long-term depression (10)
- TGF-beta signaling pathway (10)
- Endometrial cancer (8)
- Glioma (8)
- Inositol phosphate metabolism (8)
- Melanoma (8)
- Pathways in cancer (8)
- Phosphatidylinositol signaling system (8)
- Prostate cancer (8)
- Small cell lung cancer (8)
- p53 signaling pathway (8)
- Alzheimer's disease (7)
- Amyotrophic lateral sclerosis (ALS) (7)
- Apoptosis (7)
- Axon guidance (7)
- Calcium signaling pathway (7)
- Jak-STAT signaling pathway (7)
- VEGF signaling pathway (7)
- Adipocytokine signaling pathway (3)
- Chronic myeloid leukemia (3)
- Epithelial cell signaling in Helicobacter pylori infection (3)
- Leukocyte transendothelial migration (3)
- Neurotrophin signaling pathway (3)
- Renal cell carcinoma (3)
- Riboflavin metabolism (3)
- Fructose and mannose metabolism (1)
- Metabolic pathways (1)
- Thiamine metabolism (1)