Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal Anti-SPIB Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SPIB antibody was raised against a 17 amino acid peptide near the carboxy terminus of human SPIB. The immunogen is located within amino acids 200 - 250 of SPIB. |
MMP9 rabbit monoclonal antibody, clone EP1255Y, Supernatant
| Applications | IF, IHC, WB |
| Reactivities | Guinea Pig, Human |
Rabbit polyclonal IRF-3 (Ser385) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IRF-3 around the phosphorylation site of serine 385 (G-A-SP-S-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-KV11.1 (HERG) (extracellular)
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide AFLLKETEEGPPATEC corresponding to residues 430-445 of human KV11.1 (HERG). Extracellular, between S1 and S2 domains. |
Rabbit Polyclonal Anti-TARDBP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TARDBP antibody: synthetic peptide directed towards the C terminal of human TARDBP. Synthetic peptide located within the following region: MGMLASQQNQSGPSGNNQNQGNMQREPNQAFGSGNNSYSGSNSGAAIGWG |
Rabbit Polyclonal Anti-HMGB2 Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HMGB2 antibody: synthetic peptide directed towards the middle region of human HMGB2. Synthetic peptide located within the following region: DREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLS |
Rabbit Polyclonal Anti-HOXA5 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HOXA5 antibody: synthetic peptide directed towards the C terminal of human HOXA5. Synthetic peptide located within the following region: FNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSMAAAG |
Rabbit Polyclonal Anti-HOXC8 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HOXC8 antibody: synthetic peptide directed towards the N terminal of human HOXC8. Synthetic peptide located within the following region: SHALVYGPGGSAPGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGD |
Rabbit Polyclonal Anti-HNRPD Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPD antibody: synthetic peptide directed towards the N terminal of human HNRPD. Synthetic peptide located within the following region: AESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTK |
Rabbit Polyclonal Anti-ILF3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ILF3 antibody: synthetic peptide directed towards the N terminal of human ILF3. Synthetic peptide located within the following region: ALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR |
Rabbit Polyclonal antibody to Rad54 (alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S. cerevisiae))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 2161 and 2443 of Rad54 (Uniprot ID#P46100) |
Rabbit anti-STAT3 (Phospho-Tyr705) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT3 around the phosphorylation site of tyrosine 705 (A-P-YP-L-K). |
| Modifications | Phospho-specific |
Active filters
Filter by
Target Symbol
- TP53 (149)
- PGR (104)
- MAP2K3 (98)
- CTNNB1 (83)
- NKX3-1 (73)
- JUN (67)
- MDM4 (56)
- MEF2C (56)
- ESR1 (54)
- MCM2 (52)
- PPP5C (51)
- MDM2 (48)
- NR3C1 (48)
- BHLHE41 (47)
- SQSTM1 (47)
- STAT4 (45)
- TLE1 (43)
- FOS (42)
- TSC22D1 (42)
- GLI1 (40)
- SLA2 (40)
- ERG (37)
- ID3 (37)
- TP53BP1 (36)
- ZSCAN18 (36)
- NKX2-1 (35)
- RFXANK (35)
- STAT5A (35)
- SATB1 (34)
- TRIB3 (34)
- NR2C2 (33)
- PARN (33)
- CBX8 (32)
- FOXI1 (32)
- MYC (32)
- SKIL (32)
- CD80 (31)
- CLOCK (31)
- FOXP1 (31)
- NEUROG1 (31)
- TP73 (31)
- TRIM28 (31)
- AR (30)
- HDAC9 (29)
- PAX5 (29)
- SSB (29)
- APEX1 (28)
- ATF1 (28)
- ELL (28)
- NR1I3 (28)
- BCL6 (27)
- HDAC6 (27)
- MED15 (27)
- NONO (27)
- RB1 (27)
- SMAD1 (27)
- PRRX1 (26)
- TCF12 (26)
- GATA3 (25)
- HES1 (25)
- POGK (25)
- BRCA1 (24)
- IRF3 (24)
- RELA (24)
- ZEB1 (23)
- EIF4E2 (22)
- EWSR1 (22)
- LHX1 (22)
- PPP1R8 (22)
- HMG20A (21)
- MEIS1 (21)
- SP110 (21)
- CDX2 (20)
- ELK3 (20)
- FOXO4 (20)
- NR4A3 (20)
- PHF20L1 (20)
- SNAI2 (20)
- ZNF217 (20)
- ZNF69 (20)
- FOXO3 (19)
- NR0B2 (19)
- TNF (19)
- ARNT (18)
- ASH2L (18)
- ERCC8 (18)
- HDAC2 (18)
- IRF6 (18)
- PSMC3 (18)
- RUVBL2 (18)
- ZEB2 (18)
- ARNTL (17)
- GAS7 (17)
- HDAC10 (17)
- MAFB (17)
- STAT1 (17)
- CNOT2 (16)
- EZH2 (16)
- FOXO1 (16)
- KDM4C (16)
Reactivities
- Human (5859)
- Mouse (3839)
- Rat (3391)
- Monkey (381)
- Dog (371)
- Bovine (69)
- Pig (47)
- Cow (26)
- Chicken (24)
- Primate (24)
- Xenopus (18)
- Zebrafish (14)
- Hamster (12)
- Rabbit (12)
- Rhesus Monkey (10)
- Horse (8)
- Canine (7)
- Chimpanzee (7)
- X. tropicalis (6)
- Bat (5)
- Gibbon (5)
- Gorilla (5)
- Sheep (5)
- Feline (4)
- Ferret (3)
- Guinea Pig (3)
- Porcine (3)
- Goat (2)
- Canis (1)
- Drosophila (1)
- Equine (1)
- Fish (1)
- Gerbil (1)
- Macaque (1)
- Mammalian (1)
- Opossum (1)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (990)
- MAPK signaling pathway (657)
- Prostate cancer (529)
- Cell cycle (448)
- Wnt signaling pathway (438)
- Chronic myeloid leukemia (437)
- Colorectal cancer (411)
- Toll-like receptor signaling pathway (370)
- Neurotrophin signaling pathway (355)
- Pancreatic cancer (301)
- Endometrial cancer (298)
- p53 signaling pathway (296)
- Small cell lung cancer (294)
- Thyroid cancer (290)
- Basal cell carcinoma (284)
- Amyotrophic lateral sclerosis (ALS) (275)
- Bladder cancer (267)
- Huntington's disease (254)
- Apoptosis (246)
- Melanoma (241)
- Glioma (230)
- T cell receptor signaling pathway (219)
- TGF-beta signaling pathway (217)
- Non-small cell lung cancer (206)
- Jak-STAT signaling pathway (198)
- Acute myeloid leukemia (190)
- B cell receptor signaling pathway (189)
- ErbB signaling pathway (175)
- GnRH signaling pathway (174)
- Oocyte meiosis (162)
- Focal adhesion (160)
- Ubiquitin mediated proteolysis (149)
- Adherens junction (144)
- Renal cell carcinoma (133)
- Melanogenesis (129)
- Chemokine signaling pathway (128)
- Adipocytokine signaling pathway (125)
- Epithelial cell signaling in Helicobacter pylori infection (118)
- Fc epsilon RI signaling pathway (118)
- Tight junction (112)
- Circadian rhythm - mammal (106)
- Progesterone-mediated oocyte maturation (104)
- RIG-I-like receptor signaling pathway (104)
- Pathogenic Escherichia coli infection (98)
- Cytosolic DNA-sensing pathway (97)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (93)
- Maturity onset diabetes of the young (86)
- Leukocyte transendothelial migration (85)
- Systemic lupus erythematosus (83)
- RNA degradation (77)
- NOD-like receptor signaling pathway (74)
- Antigen processing and presentation (72)
- Notch signaling pathway (72)
- Endocytosis (71)
- DNA replication (69)
- Neuroactive ligand-receptor interaction (66)
- Insulin signaling pathway (64)
- Metabolic pathways (62)
- Allograft rejection (59)
- Graft-versus-host disease (59)
- Type I diabetes mellitus (59)
- Viral myocarditis (57)
- Primary immunodeficiency (48)
- Base excision repair (47)
- Hedgehog signaling pathway (42)
- Autoimmune thyroid disease (40)
- Cell adhesion molecules (CAMs) (40)
- Nucleotide excision repair (40)
- Basal transcription factors (37)
- Type II diabetes mellitus (37)
- Natural killer cell mediated cytotoxicity (35)
- Cytokine-cytokine receptor interaction (33)
- mTOR signaling pathway (33)
- Alzheimer's disease (32)
- Purine metabolism (32)
- Pyrimidine metabolism (32)
- PPAR signaling pathway (31)
- RNA polymerase (29)
- Axon guidance (27)
- Dilated cardiomyopathy (25)
- Hypertrophic cardiomyopathy (HCM) (25)
- Asthma (19)
- Hematopoietic cell lineage (19)
- Proteasome (18)
- Dorso-ventral axis formation (17)
- Lysine degradation (16)
- Long-term depression (15)
- VEGF signaling pathway (15)
- Long-term potentiation (12)
- Glycolysis / Gluconeogenesis (10)
- Non-homologous end-joining (10)
- Cysteine and methionine metabolism (8)
- Vascular smooth muscle contraction (8)
- Homologous recombination (7)
- Ribosome (7)
- Fc gamma R-mediated phagocytosis (6)
- Regulation of actin cytoskeleton (6)
- Spliceosome (6)
- Calcium signaling pathway (5)
- Prion diseases (5)
- Biosynthesis of unsaturated fatty acids (3)
- Valine (2)
- leucine and isoleucine degradation (2)
- Glycerolipid metabolism (1)
- Glycine (1)
- Glyoxylate and dicarboxylate metabolism (1)
- Nicotinate and nicotinamide metabolism (1)
- serine and threonine metabolism (1)