USD 399.00
In Stock
CD19 mouse monoclonal antibody,clone 3B10, DyLight 488 conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | DyLight 488 |
USD 399.00
In Stock
CD19 mouse monoclonal antibody,clone 3B10, DyLight 488 conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | DyLight 488 |
CD19 mouse monoclonal antibody,clone 3B10, PE conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | PE |
Rabbit Polyclonal Antibody against CD19 (N-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CD19 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 143-172 amino acids from the N-terminal region of human CD19. |
CD4 mouse monoclonal antibody, clone B-A1, Azide Free
Applications | FC, FN, IHC |
Reactivities | Human |
Rabbit Polyclonal CD4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Rabbit |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
TAP2 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TAP2 |
CD45 (PTPRC) (CD45RC) mouse monoclonal antibody, clone MT2, Aff - Purified
Applications | FC, IF, IHC |
Reactivities | Human |
Rabbit Monoclonal Antibody against CD8A (Clone EP1150Y)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against CD8A (N-term)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 59-88 amino acids from the N-terminal region of human CD8A. |
CD4 mouse monoclonal antibody, clone EDU-2, Aff - Purified
Applications | FC, IHC |
Reactivities | Human |
Rabbit polyclonal anti-CD40 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human CD40. |
CD3E mouse monoclonal antibody, clone UCHT1, Azide Free
Applications | FC, FN, IHC, IP |
Reactivities | Human, Monkey |
CD8A mouse monoclonal antibody, clone CT6, Supernatant
Applications | FC, IHC |
Reactivities | Guinea Pig |
Rabbit anti-CD3E Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CD3E |
USD 240.00
2 Weeks
CD3E (activation epitope) mouse monoclonal antibody, clone APA1/1, Aff - Purified
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse |
CD19 mouse monoclonal antibody, clone HD37, Aff - Purified
Applications | FC, IHC |
Reactivities | Human |
CD4 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide corresponding to amino acids 391-440 of Human CD4. |
CD40L (CD40LG) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to a sequence at the N-terminal of human CD40L |
CD3E mouse monoclonal antibody, clone OKT3, Low Endotoxin
Applications | FC, FN, IHC |
Reactivities | Human |
CD40 mouse monoclonal antibody, clone B-B20, Azide Free
Applications | FC, FN, IHC |
Reactivities | Human |
CD40L (CD40LG) mouse monoclonal antibody, clone B-B29, Azide Free
Applications | FC, IHC |
Reactivities | Human |
CD40 (C-term) rabbit polyclonal antibody, Purified
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | CD40 antibody was raised against a synthetic peptide derived from C-terminal of human CD40 |
Rabbit Polyclonal BAFF Receptor Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | BAFF Receptor antibody was raised against a synthetic peptide corresponding to amino acids near the carboxy terminus of human BAFF Receptor The peptide sequence is identical between human and mouse origin. |
CD45 (PTPRC) mouse monoclonal antibody, clone BRA-55, Ascites
Applications | IF, IHC, WB |
Reactivities | Human |
CD3E mouse monoclonal antibody, clone OKT3, Aff - Purified
Applications | FC, FN, IHC |
Reactivities | Human |
CD45 (PTPRC) (CD45RA) mouse monoclonal antibody, clone n.a, FITC, Purified
Applications | FC, IHC, IP |
Reactivities | Human |
Conjugation | FITC |
CD45 (PTPRC) mouse monoclonal antibody, clone PD7/26/16 + 2B11, Purified
Applications | FC, IF, IHC |
Reactivities | Human |
CD4 mouse monoclonal antibody, clone B-A1, Purified
Applications | FC, IHC |
Reactivities | Human |
CD45 (PTPRC) mouse monoclonal antibody, clone ML2, Aff - Purified
Applications | FC, IHC |
Reactivities | Human |
CD45 (PTPRC) (CD45RA) mouse monoclonal antibody, clone MB1, Aff - Purified
Applications | FC, IF, IHC |
Reactivities | Human |
CD45 (PTPRC) (CD45RB) mouse monoclonal antibody, clone MT4, Aff - Purified
Applications | FC, IF, IHC |
Reactivities | Human |
CD3E rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 31-80 of Human CD3-ε. |
CD8A mouse monoclonal antibody, clone LT8, Azide Free
Applications | FC, IHC, IP |
Reactivities | Human |
CD8A mouse monoclonal antibody, clone LT8, Purified
Applications | FC, IHC, IP |
Reactivities | Human |
CD8A mouse monoclonal antibody, clone LT8, Purified
Applications | FC, IHC, IP |
Reactivities | Human |
CD8A mouse monoclonal antibody, clone LT8, Purified
Applications | FC, IHC, IP |
Reactivities | Human, Monkey |
Rabbit Polyclonal Antibody against CD8A (C-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 150-180 amino acids from the C-terminal region of human CD8A. |
Rabbit Polyclonal Anti-TAP1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TAP1 Antibody: synthetic peptide directed towards the middle region of human TAP1. Synthetic peptide located within the following region: LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGL |
CD8A mouse monoclonal antibody, clone RFT-8, APC-Cy7
Applications | FC, IHC |
Reactivities | Human |
Conjugation | APC-Cy7 |
CD8A mouse monoclonal antibody, clone RFT-8, Cy5
Applications | FC, IHC |
Reactivities | Human |
Conjugation | Cy5 |
CD8A mouse monoclonal antibody, clone RFT-8, Low Endotoxin
Applications | FC, IHC |
Reactivities | Human |
CD8A mouse monoclonal antibody, clone RFT-8, Purified
Applications | FC, IHC |
Reactivities | Human |
CD8A mouse monoclonal antibody, clone RFT-8, PE-Cy5.5
Applications | FC, IHC |
Reactivities | Human |
Conjugation | PE-Cy5.5 |
CD8A mouse monoclonal antibody, clone RFT-8, PE-Cy7
Applications | FC, IHC |
Reactivities | Human |
Conjugation | PE-Cy7 |
CD8A mouse monoclonal antibody, clone CA-8, Aff - Purified
Applications | IHC, IP |
Reactivities | Human, Rat |
CD4 mouse monoclonal antibody, clone CA-4, Purified
Applications | IF, IHC |
Reactivities | Human |
CD19 mouse monoclonal antibody, clone AE1, Aff - Purified
Applications | FC, IHC |
Reactivities | Human |
CD3E mouse monoclonal antibody, clone CRIS-7, Aff - Purified
Applications | FC, IHC |
Reactivities | Human, Rhesus Monkey |
CD45 (PTPRC) (CD45RA) mouse monoclonal antibody, clone B-C15, Azide Free
Applications | FC, IHC |
Reactivities | Human |
CD45 (PTPRC) (CD45RA) mouse monoclonal antibody, clone B-C15, Purified
Applications | FC, IHC |
Reactivities | Human |