Germany
Japan
United Kingdom
China
Rabbit anti-LTBR Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LTBR |
Antibodies
View as table Download
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
Rabbit Polyclonal Anti-GABRA5 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABRA5 antibody: synthetic peptide directed towards the middle region of human GABRA5. Synthetic peptide located within the following region: GTSNTTSVSVKPSEEKTSESKKTYNSISKIDKMSRIVFPVLFGTFNLVYW |
Rabbit Polyclonal Anti-ACSL3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACSL3 antibody: synthetic peptide directed towards the N terminal of human ACSL3. Synthetic peptide located within the following region: LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI |
Rabbit Polyclonal CX3CR1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CX3CR1 antibody was raised against a 20 amino acid peptide near the amino terminus of human CX3CR1. The immunogen is located within the first 50 amino acids of CX3CR1. |
Rabbit polyclonal VE-Cadherin (Tyr731) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human VE-Cadherin around the phosphorylation site of tyrosine 731 (H-I-YP-G-Y). |
| Modifications | Phospho-specific |
Calneuron-1 / CALN1 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Calneuron-1 / CALN1 antibody was raised against a 16 amino acid peptide near the amino terminus of human CaBP8. |
Rabbit polyclonal ACSL4 (FACL4) Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ACSL4 (FACL4) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-267 amino acids from the Central region of human ACSL4 (FACL4). |
Rabbit polyclonal IL1R Antibody (C-term E487)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL1R antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 474-503 amino acids from the C-terminal region of human IL1R. |
Rabbit polyclonal FOLR1 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FOLR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-68 amino acids from the N-terminal region of human FOLR1. |
Rabbit anti-GP9 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GP9 |
Rabbit anti-SIGMAR1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SIGMAR1 |
Rabbit Polyclonal Antibody against CDH3 (C-term)
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CDH3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 660-688 amino acids from the C-terminal region of human CDH3. |
Rabbit Polyclonal Antibody against BCL2L2
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This Bcl antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 24-59 amino acids from human Bcl. |
Rabbit Polyclonal Antibody against TRPM8 (Center R536)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TRPM8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 521-552 amino acids from the Central region of human TRPM8. |
Rabbit polyclonal antibody to Dopamine beta-Hydroxylase (dopamine beta-hydroxylase (dopamine beta-monooxygenase))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 8 and 320 of Dopamine beta Hydroxylase (Uniprot ID#P09172) |
Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514) |
Rabbit polyclonal IGF1R (Tyr1346) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IGF1R around the phosphorylation site of tyrosine 1346 (Q-P-YP-A-H). |
| Modifications | Phospho-specific |
CCR6 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Human, Gorilla |
| Conjugation | Unconjugated |
| Immunogen | CCR6 antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human CCR6. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon (94%); Monkey (89%); Opossum (83%). |
Dopamine Receptor D1 / DRD1 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | DRD1 / Dopamine Receptor D1 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human DRD1. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon, Marmoset (95%); Elephant (90%); Dog, Rabbit (85%); Horse (80%). |
Rabbit Polyclonal Anti-UCRC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK |
Rabbit Polyclonal Calnexin Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Hamster |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal portion of the rat Calnexin protein (between residues 550-591) [UniProt P35565] |
Rabbit Polyclonal Antibody against CD8A (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 59-88 amino acids from the N-terminal region of human CD8A. |
Rabbit Polyclonal Antibody against CDH8 (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CDH8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-63 amino acids from the N-terminal region of human CDH8. |
GPR183 / EBI2 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR183 / EBI2 antibody was raised against synthetic 15 amino acid peptide from C-terminus of human GPR183 / EBI2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig (93%); Opossum, Platypus, Catfish, Zebrafish (80%). |
Rabbit Polyclonal Anti-M1 Muscarinic Receptor (443-458)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)RKIPKRPGSVHRTPSR, corresponding to amino acid residues 443-458 of human M1 Muscarinic Receptor. Intracellular, C-terminus. |
Rabbit Polyclonal Anti-GCNT3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GCNT3 Antibody: synthetic peptide directed towards the C terminal of human GCNT3. Synthetic peptide located within the following region: AICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL |
Rabbit Polyclonal Anti-CLDN11 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLDN11 antibody: synthetic peptide directed towards the C terminal of human CLDN11. Synthetic peptide located within the following region: VSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTH |
Rabbit Polyclonal Anti-VMA21 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-VMA21 Antibody: synthetic peptide directed towards the N terminal of human LOC203547. Synthetic peptide located within the following region: MERPDKAALNALQPPEFRNESSLASTLKTLLFFTALMITVPIGLYFTTKS |
Rabbit Polyclonal Anti-CD276 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CD276 antibody was raised against a peptide corresponding to 19 amino acids near the carboxy terminus of CD276. The immunogen is located within amino acids 484 - 534 of CD276. |
Prion protein PrP (PRNP) mouse monoclonal antibody, clone EM-20, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TRPV2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Horse, Human, Monkey, Pig |
| Conjugation | Unconjugated |
| Immunogen | VRL1 / TRPV2 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human TRPV2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Horse, Pig (100%); Gibbon, Bovine, Hamster, Panda, Rabbit (93%); Mouse, Dog (87%); Elephant (80%). |
Mouse anti-TACSTD2 (TROP-2) monoclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 345.00
4 Weeks
Rabbit polyclonal anti-ELOVL3 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ELOVL3. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Human
Applications
- IHC
Conjugates
- Unconjugated
Families
- Transmembrane
Citations
- Yes
Filter by
Target Symbol
- LGR5 (6)
- BAX (5)
- CD19 (5)
- CDH2 (5)
- PECAM1 (5)
- CD163 (4)
- CD274 (4)
- CD4 (4)
- CD8A (4)
- ERBB2 (4)
- MME (4)
- SLC7A8 (4)
- BCL2 (3)
- CD3E (3)
- CD44 (3)
- CD68 (3)
- CDH1 (3)
- CDH3 (3)
- EPCAM (3)
- MS4A1 (3)
- MSR1 (3)
- NCAM1 (3)
- PDCD1 (3)
- SLC18A2 (3)
- TMEM100 (3)
- ABCC4 (2)
- ABCG2 (2)
- APMAP (2)
- AQP1 (2)
- B3GNT2 (2)
- BCL2L1 (2)
- BDNF (2)
- BTN3A2 (2)
- CA9 (2)
- CCR6 (2)
- CD1C (2)
- CD34 (2)
- CD40 (2)
- CD7 (2)
- CD99 (2)
- CDH5 (2)
- CLEC4E (2)
- CTLA4 (2)
- CYP2A6 (2)
- CYP2E1 (2)
- DPP4 (2)
- DPP8 (2)
- EGFR (2)
- FBXW7 (2)
- FGFR2 (2)
- FGFR3 (2)
- ICAM1 (2)
- L1CAM (2)
- MET (2)
- MICOS10 (2)
- NEU1 (2)
- NPR3 (2)
- NTRK1 (2)
- NTRK2 (2)
- PRNP (2)
- PTCH1 (2)
- PTPRE (2)
- ROMO1 (2)
- ROR2 (2)
- SDCBP (2)
- SIL1 (2)
- SYP (2)
- TGFBR2 (2)
- TRPM4 (2)
- UBE2J1 (2)
- WFDC2 (2)
- ABCC5 (1)
- ACSL3 (1)
- ACSL4 (1)
- ADAM10 (1)
- ADCY1 (1)
- ANPEP (1)
- ANTXR1 (1)
- AQP4 (1)
- B3GLCT (1)
- BCL2L10 (1)
- BCL2L2 (1)
- BST2 (1)
- CALCRL (1)
- CALN1 (1)
- CANX (1)
- CAV1 (1)
- CD276 (1)
- CD46 (1)
- CD5 (1)
- CD63 (1)
- CD80 (1)
- CD81 (1)
- CDCP1 (1)
- CDH8 (1)
- CHRM1 (1)
- CHRNA4 (1)
- CHSY1 (1)
- CLDN11 (1)
- CR2 (1)
Antibody Hosts
Clonalities
Knockout (KO) Validation
Modifications
Pathways
- Cell adhesion molecules (CAMs) (57)
- Hematopoietic cell lineage (40)
- Pathways in cancer (35)
- Primary immunodeficiency (19)
- Metabolic pathways (18)
- Cytokine-cytokine receptor interaction (17)
- Focal adhesion (17)
- T cell receptor signaling pathway (17)
- Adherens junction (16)
- Colorectal cancer (15)
- Endocytosis (15)
- MAPK signaling pathway (15)
- Neurotrophin signaling pathway (14)
- Apoptosis (13)
- Calcium signaling pathway (12)
- Leukocyte transendothelial migration (12)
- Prostate cancer (12)
- Antigen processing and presentation (11)
- Bladder cancer (11)
- Regulation of actin cytoskeleton (11)
- Amyotrophic lateral sclerosis (ALS) (10)
- Neuroactive ligand-receptor interaction (10)
- Pancreatic cancer (10)
- Prion diseases (10)
- ECM-receptor interaction (9)
- Endometrial cancer (9)
- Huntington's disease (9)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (8)
- Lysosome (8)
- Melanoma (8)
- Viral myocarditis (8)
- Autoimmune thyroid disease (7)
- B cell receptor signaling pathway (7)
- Parkinson's disease (7)
- Small cell lung cancer (7)
- Alzheimer's disease (6)
- ErbB signaling pathway (6)
- Non-small cell lung cancer (6)
- Toll-like receptor signaling pathway (6)
- ABC transporters (5)
- Allograft rejection (5)
- Axon guidance (5)
- Drug metabolism - cytochrome P450 (5)
- Epithelial cell signaling in Helicobacter pylori infection (5)
- Gap junction (5)
- Renin-angiotensin system (5)
- Thyroid cancer (5)
- p53 signaling pathway (5)
- Adipocytokine signaling pathway (4)
- Chemokine signaling pathway (4)
- Chronic myeloid leukemia (4)
- Dilated cardiomyopathy (4)
- Natural killer cell mediated cytotoxicity (4)
- PPAR signaling pathway (4)
- Pathogenic Escherichia coli infection (4)
- Systemic lupus erythematosus (4)
- Ubiquitin mediated proteolysis (4)
- Asthma (3)
- Complement and coagulation cascades (3)
- Drug metabolism - other enzymes (3)
- Glioma (3)
- GnRH signaling pathway (3)
- Graft-versus-host disease (3)
- Hypertrophic cardiomyopathy (HCM) (3)
- Jak-STAT signaling pathway (3)
- Linoleic acid metabolism (3)
- Metabolism of xenobiotics by cytochrome P450 (3)
- Renal cell carcinoma (3)
- Retinol metabolism (3)
- Type I diabetes mellitus (3)
- Arachidonic acid metabolism (2)
- Basal cell carcinoma (2)
- Caffeine metabolism (2)
- Dorso-ventral axis formation (2)
- Fatty acid metabolism (2)
- Glycosphingolipid biosynthesis - lacto and neolacto series (2)
- Hedgehog signaling pathway (2)
- Keratan sulfate biosynthesis (2)
- Nitrogen metabolism (2)
- Oocyte meiosis (2)
- Other glycan degradation (2)
- Primary bile acid biosynthesis (2)
- Progesterone-mediated oocyte maturation (2)
- Sphingolipid metabolism (2)
- TGF-beta signaling pathway (2)
- Vascular smooth muscle contraction (2)
- Biosynthesis of unsaturated fatty acids (1)
- Cardiac muscle contraction (1)
- Chondroitin sulfate biosynthesis (1)
- Cytosolic DNA-sensing pathway (1)
- Fc gamma R-mediated phagocytosis (1)
- Galactose metabolism (1)
- Glutathione metabolism (1)
- Glycerophospholipid metabolism (1)
- Glycolysis / Gluconeogenesis (1)
- Insulin signaling pathway (1)
- Long-term depression (1)
- Long-term potentiation (1)
- Melanogenesis (1)
- N-Glycan biosynthesis (1)
- O-Glycan biosynthesis (1)
- Oxidative phosphorylation (1)
- Porphyrin and chlorophyll metabolism (1)
- Purine metabolism (1)
- RIG-I-like receptor signaling pathway (1)
- Starch and sucrose metabolism (1)
- Tight junction (1)
- Tyrosine metabolism (1)
- VEGF signaling pathway (1)