Germany
Japan
United Kingdom
China
Antibodies
Download
Collagen I (COL1A1) rabbit polyclonal antibody, Biotin
| Applications | ELISA, FC, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian, Mouse, Rat |
| Conjugation | Biotin |
| Immunogen | Collagen Type I from Human and Bovine placenta. |
CD61 (ITGB3) mouse monoclonal antibody, clone VIPL2, Aff - Purified
| Applications | FC, IHC, WB |
| Reactivities | Human, Primate |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
USD 525.00
5 Days
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Human |
| Immunogen | Purified Collagen type I from Human skin. |
USD 240.00
2 Weeks
PDGF Receptor beta (PDGFRB) mouse monoclonal antibody, clone 18A2, Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Porcine |
| Immunogen | Purified Collagen type I from Porcine tendon. |
Collagen V (COL5A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian |
| Immunogen | Collagen type V purified from Human and Bovine placenta |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit Polyclonal Anti-ACTN4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN4 antibody: synthetic peptide directed towards the N terminal of human ACTN4. Synthetic peptide located within the following region: LIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTA |
Rabbit Polyclonal antibody to Laminin beta 3 (laminin, beta 3)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 644 and 960 of Laminin beta 3 (Uniprot ID#Q13751) |
Rabbit Polyclonal Anti-PDGFB Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDGFB antibody: synthetic peptide directed towards the N terminal of human PDGFB. Synthetic peptide located within the following region: NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD |
Rabbit Polyclonal Antibody against PIK3CA (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KCA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 504-533 amino acids from the Central region of human PI3KCA. |
Active filters
Applications
- IHC
Families
- Druggable Genome
Pathways
- Focal adhesion
Filter by
Target Symbol
- MAP2K1 (183)
- ERBB2 (108)
- CTNNB1 (83)
- AKT1 (73)
- JUN (67)
- BCL2 (62)
- EGFR (59)
- PIK3CG (54)
- VWF (47)
- PIK3R5 (37)
- BRAF (30)
- MAPK1 (29)
- MAPK9 (28)
- PIK3CD (28)
- HRAS (27)
- MAPK8 (26)
- PTK2 (26)
- BCAR1 (25)
- COL1A1 (24)
- HGF (23)
- MET (23)
- PIK3CA (23)
- LAMB3 (22)
- VASP (22)
- ITGB3 (21)
- PAK1 (20)
- FN1 (19)
- SPP1 (18)
- BAD (17)
- PDGFRA (17)
- PDGFRB (17)
- EGF (16)
- IGF1 (16)
- KDR (16)
- SHC1 (16)
- SRC (16)
- MYL7 (15)
- RAPGEF1 (15)
- AKT2 (13)
- VEGFB (12)
- AKT3 (11)
- RAF1 (11)
- ACTN1 (9)
- CAV1 (9)
- COL5A1 (9)
- GSK3B (9)
- LAMA4 (9)
- PIK3R1 (9)
- PRKCA (9)
- PXN (9)
- VEGFA (9)
- ITGA6 (8)
- MAPK3 (8)
- PPP1CA (8)
- PTEN (8)
- VEGFC (8)
- CCND1 (7)
- PAK4 (7)
- PDGFB (7)
- ROCK2 (7)
- VEGFD (7)
- GRB2 (6)
- ITGB1 (6)
- PDGFA (6)
- CAPN2 (5)
- COL3A1 (5)
- ELK1 (5)
- FLT1 (5)
- IGF1R (5)
- ILK (5)
- ITGA3 (5)
- LAMB2 (5)
- PAK2 (5)
- ACTN4 (4)
- BIRC2 (4)
- CCND3 (4)
- CRK (4)
- CRKL (4)
- FYN (4)
- ITGA4 (4)
- ITGB4 (4)
- PDPK1 (4)
- PPP1CB (4)
- ROCK1 (4)
- THBS1 (4)
- TLN1 (4)
- VCL (4)
- XIAP (4)
- CAV2 (3)
- CAV3 (3)
- COL1A2 (3)
- ITGA2 (3)
- ITGA2B (3)
- LAMA1 (3)
- LAMA5 (3)
- LAMB1 (3)
- MYLK3 (3)
- PAK3 (3)
- PAK5 (3)
- PAK6 (3)
Reactivities
- Human (1498)
- Mouse (1323)
- Rat (1269)
- Dog (389)
- Monkey (347)
- Bovine (22)
- Chicken (11)
- Horse (7)
- Pig (7)
- Xenopus (7)
- Rabbit (6)
- Cow (5)
- Rhesus Monkey (5)
- Bat (4)
- X. tropicalis (4)
- Hamster (3)
- Primate (3)
- Sheep (3)
- Canine (2)
- Gorilla (2)
- Porcine (2)
- Zebrafish (2)
- Feline (1)
- Fish (1)
- Gibbon (1)
- Orang-Utan (1)