Rabbit anti-ALDH2 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ALDH2 |
Rabbit anti-ALDH2 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ALDH2 |
Rabbit anti-ACAT1 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ACAT1 |
Rabbit Polyclonal Anti-LDHB Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-LDHB antibody is: synthetic peptide directed towards the C-terminal region of Human LDHB. Synthetic peptide located within the following region: MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD |
Rabbit polyclonal antibody to PCCase beta (propionyl Coenzyme A carboxylase, beta polypeptide)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 167 and 480 of PCCB (Uniprot ID#P05166) |
Mouse monoclonal ALDH2 Antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Monoclonal Antibody against LDHA (Clone EP1563Y)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal FALDH Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
USD 480.00
2 Weeks
Lactate Dehydrogenase B (LDHB) mouse monoclonal antibody, clone 2H6
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
ACADM rabbit polyclonal antibody, Purified
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 196~225 amino acids from the Center region of Human ACADM. |
ALDH2 (N-term) rabbit polyclonal antibody, Purified
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Immunogen | This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 52-81 amino acids from the N-terminal region of human ALDH2. |
Rabbit Polyclonal Antibody against ALDH2 (Center)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 318-347 amino acids from the Central region of human ALDH2. |
Rabbit polyclonal Acetyl-CoA Carboxylase (Ser80) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human: Ser80, Mouse: Ser79, Rat: Ser79 |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human acetyl-CoA carboxylase around the phosphorylation site of serine 80 (S-M-SP-G-L). |
Modifications | Phospho-specific |
Rabbit polyclonal Acetyl-CoA Carboxylase (Ab-80) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Acetyl-CoA Carboxylase around the phosphorylation site of serine 80 (S-M-SP-G-L). |
Rabbit anti-LDHA Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human LDHA |
Rabbit Polyclonal Anti-ACAT2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACAT2 antibody: synthetic peptide directed towards the middle region of human ACAT2. Synthetic peptide located within the following region: SREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPR |
Goat Polyclonal Anti-ALDH3A2 Antibody
Applications | IHC |
Reactivities | Human (Expected from sequence similarity: Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ALDH3A2 Antibody: Peptide with sequence C-SLKREGANKLRYPP, from the internal region of the protein sequence according to NP_001026976.1; NP_000373.1. |
ACAT1 (N-term) mouse monoclonal antibody, clone AT1.H11, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
ACAT1 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide |
ACAT1 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide from Human ACAT1. Epitope: Internal. |
LDHA (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 161~190 amino acids from the Central region of Human LDHA |
Rabbit Polyclonal Antibody against ALDH6A1 (C-term)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ALDH6A1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 367-396 amino acids from the C-terminal region of human ALDH6A1. |
Rabbit polyclonal antibody to MCD (malonyl-CoA decarboxylase)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 90 and 304 of (Uniprot ID#O95822) |
Rabbit polyclonal HADHA Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This HADHA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 737-763 amino acids from the C-terminal region of human HADHA. |
Rabbit Polyclonal Lactate Dehydrogenase A/LDHA Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to a C-terminal portion of the human Lactate Dehydrogenase A protein (within residues 280-332). [Swiss-Prot# P00338] |
ACAT1 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Porcine, Rat |
Immunogen | Synthetic peptide |
PCCA (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 336-365 amino acids from the Central region of human PCCA |
Goat Polyclonal Antibody against ACADM
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RLIVAREHIDKYKN, from the C Terminus of the protein sequence according to NP_000007.1. |
Goat Anti-ALDH9A1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QKEILDKFTEEVVKQ, from the internal region of the protein sequence according to NP_000687.3. |
Goat Anti-ALDH6A1 (aa487-496) Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SRSSFRGDTN, from the internal region of the protein sequence according to NP_005580.1. |
Rabbit polyclonal ACC1 (Ser80) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ACC1 around the phosphorylation site of serine 79 (S-M-SP-G-L). |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ALDH3A2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the C terminal of human ALDH3A2. Synthetic peptide located within the following region: FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFG |
Rabbit Polyclonal Anti-ACAT1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ACAT1 Antibody: synthetic peptide directed towards the middle region of human ACAT1. Synthetic peptide located within the following region: GHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTDVYNKIH |
Rabbit Polyclonal Anti-ACAT1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ACAT1 Antibody: synthetic peptide directed towards the middle region of human ACAT1. Synthetic peptide located within the following region: SYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKL |
LDHA mouse monoclonal antibody, clone n.a, Purified
Applications | IHC |
Reactivities | Human |
Carrier-free (BSA/glycerol-free) LDHA mouse monoclonal antibody, clone OTI2C11 (formerly 2C11)
Applications | IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LDHA mouse monoclonal antibody, clone OTI2B11 (formerly 2B11)
Applications | IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LDHA mouse monoclonal antibody, clone OTI5G10 (formerly 5G10)
Applications | IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LDHA mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)
Applications | IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI5F7 (formerly 5F7)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI7B1 (formerly 7B1)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI3E2 (formerly 3E2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI5C9 (formerly 5C9)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI5A2 (formerly 5A2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI1B7 (formerly 1B7)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) ALDH3A2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)
Applications | FC, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI3D2 (formerly 3D2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI6H1 (formerly 6H1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |