Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal TTK (Ab-676) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TTK around the phosphorylation site of threonine 676 (D-T-TP-S-V). |
Rabbit polyclonal CDK4 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CDK4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 273-305 amino acids from the C-terminal region of human CDK4. |
Phospho-CDK6-Y13 Rabbit Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y13 of human CDK6 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ABL1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ABL1 |
Rabbit polyclonal Chk1 (Ser296) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Chk1 around the phosphorylation site of serine 296 (I-Q-SP-N-L). |
| Modifications | Phospho-specific |
GSK3B / GSK3 Beta Rabbit Polyclonal (pSer9) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | GSK3B / GSK3 Beta antibody was raised against synthetic peptide from human GSK3B / GSK3 Beta. |
Rabbit polyclonal Chk2 (Thr387) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Chk2 around the phosphorylation site of threonine 387 (C-G-TP-P-T). |
| Modifications | Phospho-specific |
Anti-ABL1/ABL2 (phospho-Tyr393/429) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 393/429 (D-T-Y(p)-T-A) derived from Human ABL1/2. |
| Modifications | Phospho-specific |
Anti-CDK6 (phospho-Tyr24) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 24 (G-A-Y(p)-G-K) derived from Human CDK6. |
| Modifications | Phospho-specific |
Rabbit polyclonal Phospho-CDK7(T170) Antibody
| Applications | Dot, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CDK7 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T170 of human CDK7. |
| Modifications | Phospho-specific |
Rabbit polyclonal Bi-Phospho-GSK3B(S21/29) Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This GSK3B Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S21/29 of human GSK3B. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CDK1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the C terminal of human CDC2. Synthetic peptide located within the following region: SLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM |
Rabbit polyclonal Chk2 (Thr68) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Chk2 around the phosphorylation site of Threonine 68 (V-S-TP-Q-E). |
| Modifications | Phospho-specific |
Rabbit polyclonal Plk1 phospho T210 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Anti-Polo-like Kinase pT210 Antibody was produced by repeated immunizations with a synthetic phospho peptide corresponding to aa 205-214 of Human Polo-like kinase 1 (Plk1) protein. |
Rabbit polyclonal GSK3 Beta phospho S9 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to the aa 4-12 of human GSK3 beta. |
Rabbit polyclonal anti-cdk2 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Anti-cdk2 antbody was prepared from whole rabbit serum by repeated immunizations with a synthetic peptide corresponding to the C-terminus of the human cdk-2 protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
Rabbit Polyclonal Anti-CDK7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDK7 antibody: synthetic peptide directed towards the C terminal of human CDK7. Synthetic peptide located within the following region: NRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF |
Rabbit Polyclonal Anti-CDK7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDK7 antibody: synthetic peptide directed towards the C terminal of human CDK7. Synthetic peptide located within the following region: NRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF |
Rabbit anti-ATM (Phospho-Ser1981) polyclonal antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanATM around the phosphorylation site of serine 1981 (E-G-SP-Q-S). |
| Modifications | Phospho-specific |
Rabbit polyclonal MYT1 (Ser83) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MYT1 around the phosphorylation site of serine 83 (R-V-SP-F-R). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-BUB1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human BUB1. |
Rabbit polyclonal ATR (Ser428) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ATR around the phosphorylation site of serine 428 (G-I-SP-P-K). |
| Modifications | Phospho-specific |
Anti-CDK1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 219-233 amino acids of Human Cyclin-dependent kinase 1 |
Anti-GSK3B Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 396-408 amino acids of Human glycogen synthase kinase 3 beta |
Anti-CDK6 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 13-300 amino acids of Human Cyclin-dependent kinase 6 |
Anti-GSK3B (Phospho-Tyr216) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 216 (V-S-Y(p)-I-C) derived from Human GSK3β. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-PLK1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PLK1 |
Active filters
Applications
- IHC
Isotypes
- IgG
Families
- Protein Kinase
Pathways
- Cell cycle