Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 44 of 44 results

(reset)

BDNF Rabbit Polyclonal Antibody

TA328615

USD 585.00

2 Weeks

Rabbit Polyclonal Anti-BDNF

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Peptide (C)VLEKVPVSKQLK, corresponding to amino acid residues 166-178 of human BDNF (precursor).

1 / 2

2 / 2

Previous Next

NGF Rabbit Polyclonal Antibody

TA349414

USD 380.00

In Stock

Rabbit Polyclonal Anti-NGF Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human NGF

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

BDNF Rabbit Polyclonal Antibody

TA346304

USD 475.00

5 Days

Rabbit Polyclonal Anti-BDNF Antibody

Applications	IHC, WB
Reactivities	Human, Macaque, Mouse
Conjugation	Unconjugated
Immunogen	The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

BDNF Goat Polyclonal Antibody

TA348982

USD 429.00

5 Days

Goat Polyclonal Anti-BDNF Antibody

Applications	IF, IHC
Reactivities	Human, Mouse, Rat (Expected from sequence similarity: Dog)
Conjugation	Unconjugated
Immunogen	The immunogen for Anti-BDNF Antibody: Peptide with sequence ETKCNPMGYTKE, from the internal region of the protein sequence according to NP_001700.2; NP_001700.2; NP_733928.1; NP_733929.1; NP_733930.1; NP_733931.1.

1 / 3

2 / 3

3 / 3

Previous Next

BDNF Rabbit Polyclonal Antibody

TA327032

USD 275.00

3 Weeks

Rabbit anti-BDNF Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human BDNF

1 / 3

2 / 3

3 / 3

Previous Next

BDNF Rabbit Polyclonal Antibody

TA328614

USD 585.00

2 Weeks

Rabbit Polyclonal Anti-proBDNF

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Peptide (C)DEDQKVRPNEENNKDAD, corresponding to amino acid residues 72-88 of human BDNF (precursor). Pro-domain of the BDNF protein.

1 / 3

2 / 3

3 / 3

Previous Next

NGF Rabbit Polyclonal Antibody

AP23284PU-N

USD 405.00

2 Weeks

NGF rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	Peptide mapping human NGF beta

1 / 2

2 / 2

Previous Next

Fas Ligand (FASLG) Rabbit Polyclonal Antibody

TA313465

USD 345.00

In Stock

Rabbit polyclonal FAS ligand antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human FAS ligand.

1 / 3

2 / 3

3 / 3

Previous Next

Fas Ligand (FASLG) Rabbit Polyclonal Antibody

TA590045

USD 409.00

In Stock

Rabbit Polyclonal Fas Ligand Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody was made against a protein fragment from the C Terminus Region

1 / 2

2 / 2

Previous Next

Neurotrophin 3 (NTF3) Rabbit Polyclonal Antibody

AP23334PU-N

USD 405.00

2 Weeks

Neurotrophin 3 (NTF3) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	Synthetic peptide mapping at the middle region of Human Neurotrophin-3

1 / 2

2 / 2

Previous Next

NGF Rabbit Polyclonal Antibody

TA328405

USD 285.00

5 Days

Anti-Human β-NGF Rabbit Polyclonal Antibody

Applications	ELISA, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	E.coli derived Recombinant Human β-NGF

1 / 3

2 / 3

3 / 3

Previous Next

Neurotrophin 3 (NTF3) Rabbit Polyclonal Antibody

TA328680

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-NT3

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Peptide GEIKTGNSPV(C), corresponding to amino acid residues 39-48 of mature human NT-3 (residues 177-186 of the NT-3 precursor).

1 / 2

2 / 2

Previous Next

NGF Rabbit Polyclonal Antibody

AP20675PU-N

USD 407.00

2 Weeks

NGF rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

1 / 2

2 / 2

Previous Next

Fas Ligand (FASLG) (N-term) Rabbit Polyclonal Antibody

AP22688PU-N

USD 440.00

2 Weeks

Fas Ligand (FASLG) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	FASLG antibody was raised against peptide mapping near the amino terminus of rat FAS-L

Fas Ligand (FASLG) (C-term) Rabbit Polyclonal Antibody

AP23382PU-N

USD 405.00

2 Weeks

Fas Ligand (FASLG) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	Synthetic peptide corresponding to a sequence mapping at the C-terminal of human FAS-L

BDNF Goat Polyclonal Antibody

GT41014-100

USD 400.00

2 Weeks

BDNF goat polyclonal antibody

Applications	ELISA, IHC
Reactivities	Human
Conjugation	Unconjugated

1 / 2

2 / 2

Previous Next

Neurotrophin 4 (NTF4) Rabbit Polyclonal Antibody

TA328674

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-NT4

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Peptide LGEVPAAGGSPL(C), corresponding to amino acid residues 43-52 of mature human NT-4Â (123-132 of the precursor NT-4).

1 / 2

2 / 2

Previous Next

Neurotrophin 3 (NTF3) Rabbit Polyclonal Antibody

TA328681

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-proNT-3

Applications	IHC, WB
Reactivities	Mouse, Rat
Conjugation	Unconjugated
Immunogen	Peptide (C)DTELLRQQRRYNSPR, corresponding to amino acid residues 89-103 of human NT-3 (precursor).Pro domain of the NT-3 protein.

1 / 3

2 / 3

3 / 3

Previous Next

BDNF Rabbit Polyclonal Antibody

TA328268

USD 285.00

5 Days

Anti-Human BDNF Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated
Immunogen	E.coli derived Recombinant Human BDNF

Fas Ligand (FASLG) Goat Polyclonal Antibody

TA328307

USD 285.00

5 Days

Anti-Human sFas Ligand Goat Polyclonal Antibody

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated
Immunogen	CHO cell derived recombinant Human sFas Ligand.

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody [Clone ID: OTI5A2]

CF500030

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) NT3 mouse monoclonal antibody, clone OTI5A2 (formerly 5A2)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody [Clone ID: OTI3D4]

CF500032

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) NT3 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Neurotrophin 4 (NTF4) Mouse Monoclonal Antibody [Clone ID: OTI2E8]

CF500034

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) NT4 mouse monoclonal antibody, clone OTI2E8 (formerly 2E8)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

NGF Rabbit Polyclonal Antibody

TA321493

USD 345.00

4 Weeks

Anti-NGF Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 80-94 amino acids of human nerve growth factor (beta polypeptide)

1 / 3

2 / 3

3 / 3

Previous Next

Neurotrophin 4 (NTF4) Rabbit Polyclonal Antibody

TA322527

USD 345.00

In Stock

Anti-NTF4 Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 25-210 amino acids of human neurotrophin 4

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

BDNF Rabbit Polyclonal Antibody

TA323908

USD 345.00

In Stock

Anti-BDNF Rabbit Polyclonal Antibody

Applications	ELISA, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 19-247 amino acids of human brain-derived neurotrophic factor

BDNF Rabbit Polyclonal Antibody

TA323909

USD 345.00

In Stock

Anti-BDNF Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 153-168 amino acids of Human brain-derived neurotrophic factor

Fas Ligand (FASLG) Rabbit Polyclonal Antibody

TA350662

USD 345.00

In Stock

Rabbit Polyclonal Anti-FASLG Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human FASLG

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody [Clone ID: OTI5A2]

TA500030

USD 379.00

In Stock

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5A2 (formerly 5A2)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5A2]

TA500030AM

USD 420.00

4 Weeks

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5A2 (formerly 5A2), Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5A2]

TA500030BM

USD 420.00

4 Weeks

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5A2 (formerly 5A2), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody [Clone ID: OTI5A2]

TA500030S

USD 159.00

In Stock

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5A2 (formerly 5A2)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody [Clone ID: OTI3D4]

TA500032

USD 379.00

In Stock

NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3D4]

TA500032AM

USD 420.00

4 Weeks

NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI3D4 (formerly 3D4), Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D4]

TA500032BM

USD 420.00

4 Weeks

NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI3D4 (formerly 3D4), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody [Clone ID: OTI3D4]

TA500032S

USD 159.00

In Stock

NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Neurotrophin 4 (NTF4) Mouse Monoclonal Antibody [Clone ID: OTI2E8]

TA500034

USD 379.00

In Stock

NT4 (Neurotrophin 4) mouse monoclonal antibody, clone OTI2E8 (formerly 2E8)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

Neurotrophin 4 (NTF4) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E8]

TA500034AM

USD 420.00

5 Days

NT4 mouse monoclonal antibody, clone 2E8, Biotinylated

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

Neurotrophin 4 (NTF4) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E8]

TA500034BM

USD 420.00

5 Days

NT4 mouse monoclonal antibody, clone 2E8, HRP conjugated

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

Neurotrophin 4 (NTF4) Mouse Monoclonal Antibody [Clone ID: OTI2E8]

TA500034S

USD 159.00

In Stock

NT4 (Neurotrophin 4) mouse monoclonal antibody, clone OTI2E8 (formerly 2E8)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody [Clone ID: OTI5C7]

TA500115

USD 379.00

In Stock

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5C7]

TA500115AM

USD 420.00

4 Weeks

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5C7 (formerly 5C7), Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5C7]

TA500115BM

USD 420.00

4 Weeks

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5C7 (formerly 5C7), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody [Clone ID: OTI5C7]

TA500115S

USD 159.00

In Stock

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

1 - 44 of 44 results