Germany
Japan
United Kingdom
China
USD 399.00
In Stock
Antibodies
View as table Download
Rabbit Polyclonal Antibody against CD19 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD19 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 143-172 amino acids from the N-terminal region of human CD19. |
CD4 mouse monoclonal antibody, clone B-A1, Azide Free
| Applications | FC, FN, IHC |
| Reactivities | Human |
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
CD45 (PTPRC) (CD45RC) mouse monoclonal antibody, clone MT2, Aff - Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
Rabbit Polyclonal Antibody against CD8A (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 59-88 amino acids from the N-terminal region of human CD8A. |
CD4 mouse monoclonal antibody, clone EDU-2, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human |
CD3E mouse monoclonal antibody, clone UCHT1, Azide Free
| Applications | FC, FN, IHC, IP |
| Reactivities | Human, Monkey |
CD8A mouse monoclonal antibody, clone CT6, Supernatant
| Applications | FC, IHC |
| Reactivities | Guinea Pig |
Rabbit anti-CD3E Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CD3E |
USD 240.00
2 Weeks
CD19 mouse monoclonal antibody, clone HD37, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human |
CD3E mouse monoclonal antibody, clone OKT3, Low Endotoxin
| Applications | FC, FN, IHC |
| Reactivities | Human |
CD40 (C-term) rabbit polyclonal antibody, Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | CD40 antibody was raised against a synthetic peptide derived from C-terminal of human CD40 |
Rabbit Polyclonal BAFF Receptor Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | BAFF Receptor antibody was raised against a synthetic peptide corresponding to amino acids near the carboxy terminus of human BAFF Receptor The peptide sequence is identical between human and mouse origin. |
CD45 (PTPRC) mouse monoclonal antibody, clone BRA-55, Ascites
| Applications | IF, IHC, WB |
| Reactivities | Human |
CD3E mouse monoclonal antibody, clone OKT3, Aff - Purified
| Applications | FC, FN, IHC |
| Reactivities | Human |
CD45 (PTPRC) (CD45RA) mouse monoclonal antibody, clone n.a, FITC, Purified
| Applications | FC, IHC, IP |
| Reactivities | Human |
| Conjugation | FITC |
CD45 (PTPRC) mouse monoclonal antibody, clone PD7/26/16 + 2B11, Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
CD4 mouse monoclonal antibody, clone B-A1, Purified
| Applications | FC, IHC |
| Reactivities | Human |
CD45 (PTPRC) mouse monoclonal antibody, clone ML2, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human |
CD45 (PTPRC) (CD45RA) mouse monoclonal antibody, clone MB1, Aff - Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
CD45 (PTPRC) (CD45RB) mouse monoclonal antibody, clone MT4, Aff - Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
CD8A mouse monoclonal antibody, clone LT8, Azide Free
| Applications | FC, IHC, IP |
| Reactivities | Human |
CD8A mouse monoclonal antibody, clone LT8, Purified
| Applications | FC, IHC, IP |
| Reactivities | Human |
CD8A mouse monoclonal antibody, clone LT8, Purified
| Applications | FC, IHC, IP |
| Reactivities | Human |
CD8A mouse monoclonal antibody, clone LT8, Purified
| Applications | FC, IHC, IP |
| Reactivities | Human, Monkey |
Rabbit Polyclonal Antibody against CD8A (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 150-180 amino acids from the C-terminal region of human CD8A. |
Rabbit Polyclonal Anti-TAP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TAP1 Antibody: synthetic peptide directed towards the middle region of human TAP1. Synthetic peptide located within the following region: LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGL |
CD8A mouse monoclonal antibody, clone RFT-8, APC-Cy7
| Applications | FC, IHC |
| Reactivities | Human |
| Conjugation | APC-Cy7 |
CD8A mouse monoclonal antibody, clone RFT-8, Cy5
| Applications | FC, IHC |
| Reactivities | Human |
| Conjugation | Cy5 |
CD8A mouse monoclonal antibody, clone RFT-8, Low Endotoxin
| Applications | FC, IHC |
| Reactivities | Human |
CD8A mouse monoclonal antibody, clone RFT-8, Purified
| Applications | FC, IHC |
| Reactivities | Human |
CD8A mouse monoclonal antibody, clone RFT-8, PE-Cy5.5
| Applications | FC, IHC |
| Reactivities | Human |
| Conjugation | PE-Cy5.5 |
CD8A mouse monoclonal antibody, clone RFT-8, PE-Cy7
| Applications | FC, IHC |
| Reactivities | Human |
| Conjugation | PE-Cy7 |
CD8A mouse monoclonal antibody, clone CA-8, Aff - Purified
| Applications | IHC, IP |
| Reactivities | Human, Rat |
CD4 mouse monoclonal antibody, clone CA-4, Purified
| Applications | IF, IHC |
| Reactivities | Human |
CD19 mouse monoclonal antibody, clone AE1, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human |
CD3E mouse monoclonal antibody, clone CRIS-7, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human, Rhesus Monkey |
CD45 (PTPRC) (CD45RA) mouse monoclonal antibody, clone B-C15, Azide Free
| Applications | FC, IHC |
| Reactivities | Human |
CD45 (PTPRC) (CD45RA) mouse monoclonal antibody, clone B-C15, Purified
| Applications | FC, IHC |
| Reactivities | Human |
Active filters
Applications
- IHC
Families
- Transmembrane
Pathways
- Primary immunodeficiency