Germany
Japan
United Kingdom
China
Red Blood Cells rabbit polyclonal antibody, Purified
| Applications | AGG, IHC |
| Reactivities | Human |
| Immunogen | Human washed pooled Red Blood Cells (RBC) |
Antibodies
Goat Anti-Rabbit IgG Secondary Antibody
| Applications | WB, IHC, IF/ICC, ELISA |
| Reactivities | Rabbit IgG |
| Conjugation | Unconjugated |
| Immunogen | Rabbit IgG, whole molecule |
Ki67 (MKI67) (C-term) rabbit monoclonal antibody, clone SP6, Supernatant
| Applications | IHC |
| Reactivities | Human, Mouse |
Goat Anti-Mouse IgG Secondary Antibody
| Applications | WB, IHC, IF/ICC, ELISA |
| Reactivities | Mouse IgG |
| Conjugation | Unconjugated |
| Immunogen | Mouse IgG, whole molecule |
Biotin Conjugated Goat Anti-Rabbit IgG
| Applications | WB: 1:200-400; ICC: 1:100-200; IHC: 1:100-200; ELISA: 1:5,000-20,000 |
| Reactivities | Rabbit IgG |
| Conjugation | Biotin |
| Immunogen | Rabbit IgG, whole molecule |
Vsx2 (N-term) sheep polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Mouse, Rat |
| Immunogen | A recombinant protein corresponding to amino acids 1 to 131 derived from the N-terminal of the Human Chx10 protein conjugated to GST. |
Rabbit Anti-Mouse IgG Secondary Antibody
| Applications | WB, IHC, IF/ICC, ELISA |
| Reactivities | Mouse IgG |
| Conjugation | Unconjugated |
| Immunogen | Mouse IgG, whole molecule |
Collagen II (COL2A1) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mouse, Rat, Sheep |
| Immunogen | Collagen type II purified from Human knee and Bovine nasal cartilage. |
Pdpn hamster monoclonal antibody, clone 811, Purified
| Applications | IHC, IP, WB |
| Reactivities | Mouse |
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit Polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 194 and 475 of MX1 (Uniprot ID#P20591) |
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
DiMethyl-Histone H3-K4 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K4 of human histone H3 |
DiMethyl-Histone H3-K36 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K36 of human histone H3 |
Tcl1 (TCL1A) mouse monoclonal antibody, clone MRQ-7, Supernatant
| Applications | IHC |
| Reactivities | Human |
GFP (Ads. to Hu, Ms, Rt Serum Proteins) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | A. victoria |
| Immunogen | Green Fluorescent Protein (GFP) fusion protein corresponding to the full length amino acid sequence (246aa) derived from the jellyfish Aequorea victoria |
Symmetric DiMethyl-Histone H3-R8 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding R8 of human histone H3 |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Rabbit Polyclonal OCLN Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | OCLN antibody was raised against a 15 amino acid synthetic peptide from near the carboxy terminus of human OCLN. The immunogen is located within the last 50 amino acids of OCLN. |
Calca rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Human, Mammalian, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic rat alpha-CGRP coupled to bovine thyroglobulin (BTg) with glutaraldehyde. |
Rabbit Polyclonal Anti-HNRPH1 Antibody - middle region
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPH1 antibody: synthetic peptide directed towards the middle region of human HNRPH1. Synthetic peptide located within the following region: FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG |
Rabbit Polyclonal Anti-TET1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | TET1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human TET1. The immunogen is located within amino acids 2030 - 2080 of TET1. |
Laminin 5 (LAMB3) mouse monoclonal antibody, clone 6F12, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Rat |
Vsx2 (C-term) sheep polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Mouse, Rat |
| Immunogen | A recombinant protein corresponding to amino acids 264 to 361 derived from the C terminal of the Human Chx10 protein conjugated to KLH. |
Hepatitis B Core Antigen / HBcAg rabbit polyclonal antibody, Ig Fraction
| Applications | IHC |
| Reactivities | Human |
| Immunogen | Purified hepatitis B core antigen. |
Rabbit Polyclonal IRAK-M Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
Active filters
Applications
- IHC
Isotypes
- IgG
Filter by
Target Symbol
- AKT1 (32)
- TP53 (22)
- CASP3 (21)
- H3-4 (19)
- JUN (19)
- RELA (19)
- BAD (18)
- STAT1 (18)
- STAT3 (18)
- BCL2 (17)
- C3 (17)
- ESR1 (17)
- IRS1 (16)
- YAP1 (16)
- ALB (15)
- CREB1 (15)
- GSK3B (15)
- HIF1A (15)
- HISTONE H3 (15)
- EGFR (14)
- EIF4EBP1 (14)
- FOXO1 (14)
- HDAC2 (14)
- MKI67 (14)
- APP (13)
- BAX (13)
- MAPK14 (13)
- NR3C1 (13)
- SMAD3 (13)
- UBB (13)
- VEGFA (13)
- ATF2 (12)
- BRCA1 (12)
- CASP7 (12)
- HSPB1 (12)
- MAP1LC3B (12)
- MMP9 (12)
- NFKBIA (12)
- PTEN (12)
- RB1 (12)
- TNF (12)
- VASP (12)
- BRAF (11)
- CASP9 (11)
- CDH1 (11)
- GCG (11)
- GFAP (11)
- H3C1 (11)
- KEAP1 (11)
- LGALS3 (11)
- LTF (11)
- NOTCH1 (11)
- XRCC6 (11)
- ALK (10)
- ATG5 (10)
- CALB1 (10)
- CCNB1 (10)
- CD274 (10)
- CD44 (10)
- CDKN1B (10)
- CTNNB1 (10)
- CXCR4 (10)
- CYCS (10)
- JUP (10)
- KRT18 (10)
- KRT8 (10)
- MAP1LC3A (10)
- MAPK1 (10)
- MUC1 (10)
- NOS2 (10)
- PAK1 (10)
- PIAS3 (10)
- SMAD2 (10)
- STAT5B (10)
- STIP1 (10)
- STMN1 (10)
- TGFB1 (10)
- TLR2 (10)
- VIM (10)
- APC (9)
- BCL2L1 (9)
- CASP1 (9)
- CCNE1 (9)
- CDKN1A (9)
- COL1A1 (9)
- CXCL12 (9)
- ENO1 (9)
- ERBB2 (9)
- F13A1 (9)
- FOXO4 (9)
- GAPDH (9)
- HDAC5 (9)
- LAMP1 (9)
- LYZ (9)
- MAPT (9)
- MMP2 (9)
- MRE11 (9)
- NFKB1 (9)
- NRG1 (9)
- PECAM1 (9)
Reactivities
- Human (22901)
- Mouse (16153)
- Rat (11800)
- Bovine (481)
- Monkey (307)
- Dog (293)
- Pig (282)
- Gorilla (157)
- Rabbit (145)
- Chicken (143)
- Cow (122)
- Gibbon (122)
- Hamster (117)
- Rhesus Monkey (110)
- Xenopus (107)
- Horse (90)
- Chimpanzee (88)
- Zebrafish (78)
- X. tropicalis (71)
- Bat (70)
- Orang-Utan (33)
- Primate (26)
- Other (Wide Range) (24)
- Guinea Pig (21)
- Canine (20)
- Sheep (15)
- Feline (13)
- Porcine (10)
- Macaque (8)
- Murine (6)
- Drosophila (5)
- Equine (4)
- All Species (3)
- C. elegans (3)
- Goat (3)
- Mammalian (3)
- SARS-CoV-2 (3)
- Broad (2)
- Fish (2)
- Fusion proteins containing the Flag Tag (2)
- Opossum (2)
- SARS-CoV (2)
- Canis (1)
- Carp (1)
- Drosophila melanogaster (1)
- Escherichia coli (1)
- Ferret (1)
- Frog (1)
- Medaka fish (1)
- Pufferfish (1)
- Quail (1)
- Staphylococcus aureus (1)
- Tadpole (1)
- Vertebrates (1)
- Yeast (1)
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
- Unmodified (2395)
- Phospho-specific (470)
- Acetyl K12 (2)
- Acetyl K5 (2)
- Phospho S127 (2)
- Phospho S39 (2)
- Phospho S727 (2)
- Phospho S795 (2)
- TriMethyl K56 (2)
- Acetyl K15 (1)
- Acetyl K18 (1)
- Acetyl K23 (1)
- Acetyl K27 (1)
- Acetyl K56 (1)
- Acetyl K8 (1)
- Acetyl K9 (1)
- Acetyl K9/K14/K18/K23/K27 (1)
- Asymmetric DiMethyl R3 (1)
- DiMethyl K385 (1)
- MonoMethyl K36 (1)
- Pan DiMethyl-lysine (1)
- Phospho S1 (1)
- Phospho S10 (1)
- Phospho S10/T11 (1)
- Phospho S104 (1)
- Phospho S1177 (1)
- Phospho S1248 (1)
- Phospho S15 (1)
- Phospho S157 (1)
- Phospho S182 (1)
- Phospho S240/244 (1)
- Phospho S243 (1)
- Phospho S280 (1)
- Phospho S33 (1)
- Phospho S33/S37/T41 (1)
- Phospho S37 (1)
- Phospho S376 (1)
- Phospho S425 (1)
- Phospho S428 (1)
- Phospho S455 (1)
- Phospho S465/467 + S423/425 (1)
- Phospho S473 (1)
- Phospho S473,Phospho S474,Phospho S472 (1)
- Phospho S5 (1)
- Phospho S51 (1)
- Phospho S529 (1)
- Phospho S612 (1)
- Phospho S62 (1)
- Phospho S73 (1)
- Phospho S80 (1)
- Phospho S82 (1)
- Phospho S89 (1)
- Phospho S957 (1)
- Phospho Ser416 (1)
- Phospho T11 (1)
- Phospho T17 (1)
- Phospho T179 (1)
- Phospho T18/S19 (1)
- Phospho T183/T172 (1)
- Phospho T1989 (1)
- Phospho T202/Y204 + T185/Y187 (1)
- Phospho T24,Phospho T32,Phospho T28 (1)
- Phospho T286 (1)
- Phospho T308 (1)
- Phospho T32 (1)
- Phospho T320 (1)
- Phospho T37/46 (1)
- Phospho T389 (1)
- Phospho T45 (1)
- Phospho T58 (1)
- Phospho T6 (1)
- Phospho T69/71 (1)
- Phospho T69/T71 (1)
- Phospho T70 (1)
- Phospho T91 (1)
- Phospho Y1007/1008 (1)
- Phospho Y1217 (1)
- Phospho Y1349 (1)
- Phospho Y15 (1)
- Phospho Y182 (1)
- Phospho Y207 (1)
- Phospho Y245 (1)
- Phospho Y412 (1)
- Phospho Y694 (1)
- Phospho Y705 (1)
- phospho T1079,Phospho T1041 (1)
Assay Types
Families
- Druggable Genome (7430)
- Transmembrane (3221)
- Transcription Factors (1770)
- Secreted Protein (1231)
- Protein Kinase (809)
- ES Cell Differentiation/IPS (732)
- Stem cell - Pluripotency (483)
- Protease (466)
- GPCR (388)
- Adult stem cells (160)
- Phosphatase (128)
- Embryonic stem cells (119)
- Nuclear Hormone Receptor (116)
- Cancer stem cells (97)
- Ion Channels: Other (92)
- Induced pluripotent stem cells (82)
- Stem cell relevant signaling - JAK/STAT signaling pathway (77)
- P450 (60)
- Ion Channels: Potassium (59)
- Stem cell relevant signaling - DSL/Notch pathway (48)
- Ion Channels: Transient receptor potential (42)
- Stem cell relevant signaling - Wnt Signaling pathway (42)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (41)
- Ion Channels: Glutamate Receptors (32)
- Ion Channels: Cys-loop Receptors (31)
- Ion Channels: Sodium (19)
- Ion Channels: Cyclic nucleotide gated (8)
- Ion Channels: Calcium (7)
- Ion Channels: ATP Receptors (6)
Pathways
- Metabolic pathways (929)
- Pathways in cancer (925)
- MAPK signaling pathway (550)
- Focal adhesion (450)
- Cytokine-cytokine receptor interaction (413)
- Chemokine signaling pathway (392)
- Neuroactive ligand-receptor interaction (360)
- Neurotrophin signaling pathway (354)
- Prostate cancer (334)
- Regulation of actin cytoskeleton (330)
- Apoptosis (305)
- Cell cycle (301)
- Wnt signaling pathway (298)
- Insulin signaling pathway (295)
- Colorectal cancer (286)
- Jak-STAT signaling pathway (284)
- Toll-like receptor signaling pathway (284)
- Chronic myeloid leukemia (282)
- Alzheimer's disease (279)
- Pancreatic cancer (274)
- Small cell lung cancer (266)
- Huntington's disease (264)
- T cell receptor signaling pathway (264)
- ErbB signaling pathway (258)
- Endocytosis (251)
- Leukocyte transendothelial migration (248)
- Calcium signaling pathway (241)
- Adipocytokine signaling pathway (227)
- Acute myeloid leukemia (217)
- Progesterone-mediated oocyte maturation (216)
- Melanoma (208)
- Tight junction (201)
- Melanogenesis (200)
- Endometrial cancer (197)
- Natural killer cell mediated cytotoxicity (197)
- p53 signaling pathway (197)
- B cell receptor signaling pathway (193)
- Oocyte meiosis (192)
- Fc gamma R-mediated phagocytosis (190)
- Axon guidance (188)
- Glioma (187)
- Renal cell carcinoma (187)
- Amyotrophic lateral sclerosis (ALS) (186)
- Non-small cell lung cancer (183)
- GnRH signaling pathway (176)
- Ubiquitin mediated proteolysis (176)
- VEGF signaling pathway (172)
- Adherens junction (168)
- Parkinson's disease (167)
- Vascular smooth muscle contraction (165)
- TGF-beta signaling pathway (159)
- mTOR signaling pathway (159)
- Cell adhesion molecules (CAMs) (156)
- Gap junction (153)
- NOD-like receptor signaling pathway (152)
- RIG-I-like receptor signaling pathway (152)
- Fc epsilon RI signaling pathway (147)
- Bladder cancer (146)
- Epithelial cell signaling in Helicobacter pylori infection (144)
- Long-term potentiation (132)
- Basal cell carcinoma (131)
- Purine metabolism (126)
- Pathogenic Escherichia coli infection (123)
- ECM-receptor interaction (120)
- PPAR signaling pathway (120)
- Dilated cardiomyopathy (118)
- Complement and coagulation cascades (113)
- Long-term depression (113)
- Hematopoietic cell lineage (111)
- Glycolysis / Gluconeogenesis (109)
- Systemic lupus erythematosus (108)
- Hypertrophic cardiomyopathy (HCM) (107)
- Type II diabetes mellitus (106)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (104)
- Viral myocarditis (101)
- Cytosolic DNA-sensing pathway (100)
- Hedgehog signaling pathway (99)
- Lysosome (93)
- Antigen processing and presentation (91)
- Notch signaling pathway (86)
- Oxidative phosphorylation (85)
- Prion diseases (80)
- Thyroid cancer (80)
- Spliceosome (78)
- Metabolism of xenobiotics by cytochrome P450 (77)
- Drug metabolism - cytochrome P450 (73)
- Arginine and proline metabolism (72)
- Phosphatidylinositol signaling system (65)
- Fatty acid metabolism (64)
- Type I diabetes mellitus (63)
- Regulation of autophagy (60)
- Valine (60)
- Arachidonic acid metabolism (59)
- Pyruvate metabolism (59)
- Tyrosine metabolism (59)
- Cardiac muscle contraction (58)
- Alanine (56)
- Vibrio cholerae infection (56)
- aspartate and glutamate metabolism (56)
- Pyrimidine metabolism (55)
- Tryptophan metabolism (54)
- leucine and isoleucine degradation (54)
- Base excision repair (50)
- RNA degradation (50)
- Dorso-ventral axis formation (49)
- Retinol metabolism (49)
- ABC transporters (48)
- Butanoate metabolism (48)
- Glutathione metabolism (47)
- Nucleotide excision repair (47)
- Citrate cycle (TCA cycle) (46)
- Starch and sucrose metabolism (46)
- Allograft rejection (45)
- Primary immunodeficiency (45)
- Glycerolipid metabolism (44)
- Inositol phosphate metabolism (44)
- Ribosome (44)
- DNA replication (43)
- Fructose and mannose metabolism (43)
- Graft-versus-host disease (43)
- Autoimmune thyroid disease (42)
- Proteasome (42)
- Cysteine and methionine metabolism (41)
- Lysine degradation (38)
- Maturity onset diabetes of the young (38)
- Histidine metabolism (37)
- Glycerophospholipid metabolism (35)
- Homologous recombination (35)
- Sphingolipid metabolism (35)
- Androgen and estrogen metabolism (34)
- Taste transduction (34)
- Galactose metabolism (33)
- Mismatch repair (33)
- Olfactory transduction (33)
- Propanoate metabolism (33)
- Basal transcription factors (32)
- Renin-angiotensin system (32)
- Phenylalanine metabolism (30)
- Drug metabolism - other enzymes (29)
- Porphyrin and chlorophyll metabolism (29)
- SNARE interactions in vesicular transport (29)
- Amino sugar and nucleotide sugar metabolism (28)
- Glycine (28)
- serine and threonine metabolism (28)
- Nitrogen metabolism (27)
- Pentose phosphate pathway (26)
- beta-Alanine metabolism (26)
- Non-homologous end-joining (25)
- Linoleic acid metabolism (24)
- Primary bile acid biosynthesis (24)
- Biosynthesis of unsaturated fatty acids (23)
- Nicotinate and nicotinamide metabolism (22)
- Terpenoid backbone biosynthesis (22)
- Asthma (21)
- N-Glycan biosynthesis (21)
- C21-Steroid hormone metabolism (19)
- Ether lipid metabolism (19)
- Aminoacyl-tRNA biosynthesis (18)
- Folate biosynthesis (17)
- Pentose and glucuronate interconversions (17)
- Riboflavin metabolism (17)
- Limonene and pinene degradation (16)
- Glycosaminoglycan degradation (15)
- Synthesis and degradation of ketone bodies (15)
- Taurine and hypotaurine metabolism (15)
- Glyoxylate and dicarboxylate metabolism (14)
- Selenoamino acid metabolism (14)
- Ascorbate and aldarate metabolism (13)
- O-Glycan biosynthesis (13)
- One carbon pool by folate (13)
- Methane metabolism (12)
- Circadian rhythm - mammal (11)
- Other glycan degradation (11)
- Pantothenate and CoA biosynthesis (11)
- alpha-Linolenic acid metabolism (10)
- leucine and isoleucine biosynthesis (9)
- Chondroitin sulfate biosynthesis (8)
- Glycosphingolipid biosynthesis - ganglio series (8)
- Glycosphingolipid biosynthesis - lacto and neolacto series (8)
- D-Glutamine and D-glutamate metabolism (7)
- Steroid biosynthesis (7)
- Caffeine metabolism (6)
- Cyanoamino acid metabolism (6)
- Fatty acid biosynthesis (6)
- Glycosphingolipid biosynthesis - globo series (6)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (6)
- Keratan sulfate biosynthesis (6)
- Lysine biosynthesis (6)
- Sulfur metabolism (6)
- Fatty acid elongation in mitochondria (5)
- Heparan sulfate biosynthesis (5)
- Phenylalanine (5)
- RNA polymerase (5)
- Vitamin B6 metabolism (5)
- tyrosine and tryptophan biosynthesis (5)
- Protein export (4)
- Thiamine metabolism (3)
- O-Mannosyl glycan biosynthesis (2)
- Ubiquinone and other terpenoid-quinone biosynthesis (1)