Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5H8
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E3
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit polyclonal HLA-G Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HLA-G antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the Central region of human HLA-G. |
Rabbit polyclonal PECAM-1 (Ab-713) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
Rabbit polyclonal Syndecan4 (Ab-179) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Syndecan4 around the phosphorylation site of serine 179 (E-G-SP-Y-D). |
Rabbit polyclonal VE-Cadherin (Tyr731) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human VE-Cadherin around the phosphorylation site of tyrosine 731 (H-I-YP-G-Y). |
| Modifications | Phospho-specific |
Rabbit anti-ITGB2 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ITGB2 |
Rabbit Polyclonal Anti-CLDN11 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLDN11 antibody: synthetic peptide directed towards the C terminal of human CLDN11. Synthetic peptide located within the following region: VSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTH |
Rabbit Polyclonal Anti-CD276 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CD276 antibody was raised against a peptide corresponding to 19 amino acids near the carboxy terminus of CD276. The immunogen is located within amino acids 484 - 534 of CD276. |
Rabbit anti-CD99 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CD99 |
ITGAV Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human ITGAV |
Rabbit anti-ITGAL Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Protein of human ITGAL |
Rabbit anti-PVRL2 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PVRL2 |
Rabbit Polyclonal Anti-CLDN23 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLDN23 antibody: synthetic peptide directed towards the C terminal of human CLDN23. Synthetic peptide located within the following region: IKYYSDGQHRPPPAQHRKPKPKPKVGFPMPRPRPKAYTNSVDVLDGEGWE |
Rabbit polyclonal SELL Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SELL antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 346-372 amino acids from the C-terminal region of human SELL. |
F11R Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human F11R |
SELL Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SELL |
CD40 (C-term) rabbit polyclonal antibody, Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | CD40 antibody was raised against a synthetic peptide derived from C-terminal of human CD40 |
Rabbit polyclonal Integrin beta1 (Thr789) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Integrin β1 around the phosphorylation site of threonine 789 (V-T-TP-V-V). |
| Modifications | Phospho-specific |
Active filters
Applications
- IHC
Isotypes
- IgG
Pathways
- Cell adhesion molecules (CAMs)
Filter by
Category
Target Symbol
- CD274 (7)
- CDH1 (7)
- CLDN1 (5)
- CLDN7 (5)
- CDH5 (4)
- CLDN5 (4)
- PECAM1 (4)
- CADM3 (3)
- CD40 (3)
- CD8A (3)
- CLDN10 (3)
- CLDN11 (3)
- CLDN3 (3)
- CLDN4 (3)
- GLG1 (3)
- ICAM1 (3)
- ITGB2 (3)
- PDCD1 (3)
- PTPRM (3)
- ALCAM (2)
- CD80 (2)
- CD99 (2)
- CDH3 (2)
- CLDN19 (2)
- CLDN23 (2)
- CLDN8 (2)
- F11R (2)
- ITGA6 (2)
- ITGAL (2)
- ITGAM (2)
- ITGAV (2)
- ITGB1 (2)
- MPZ (2)
- NECTIN2 (2)
- PDCD1LG2 (2)
- PTPRC (2)
- SELE (2)
- SELL (2)
- SMURF2 (2)
- VCAM1 (2)
- CADM1 (1)
- CD22 (1)
- CD226 (1)
- CD276 (1)
- CD40LG (1)
- CD6 (1)
- CD86 (1)
- CDH15 (1)
- CDH2 (1)
- CDH4 (1)
- CLDN17 (1)
- CLDN2 (1)
- CLDN6 (1)
- CNTN1 (1)
- HLA-A (1)
- HLA-B (1)
- HLA-DMA (1)
- HLA-DMB (1)
- HLA-DPB1 (1)
- HLA-F (1)
- HLA-G (1)
- ICAM2 (1)
- ICAM3 (1)
- ICOS (1)
- ICOSLG (1)
- ITGA4 (1)
- ITGB7 (1)
- JAM2 (1)
- L1CAM (1)
- MAG (1)
- NCAM1 (1)
- NECTIN1 (1)
- NECTIN3 (1)
- NFASC (1)
- NLGN1 (1)
- NRCAM (1)
- PVR (1)
- SDC1 (1)
- SDC4 (1)
- SELPLG (1)
- SPN (1)
- VCAN (1)