Antibodies

View as table Download

Calnexin (CANX) mouse monoclonal antibody, clone 3H4A7, Ascites

Applications ELISA, IF, IHC, WB
Reactivities Bovine, Equine, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat

HSP70-1A (HSPA1A) mouse monoclonal antibody, clone SJ-70, Purified

Applications IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated

CREB1 mouse monoclonal antibody, clone 3F1-1B2, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human

Calreticulin (CALR) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FC, IHC, WB
Reactivities Human, Rat
Immunogen This CALR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 277-305 amino acids from the Central region of Human CALR.

NKG2C (KLRC2) (N-term) rabbit polyclonal antibody

Applications ELISA, FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Human KLRC2.

beta 2 Microglobulin (B2M) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Human
Immunogen Human b2-Microglobulin.

Rabbit Polyclonal antibody to HSPA6 (heat shock 70kDa protein 6 (HSP70B'))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 377 and 628 of HSPA6 (Uniprot ID#P17066)

B2M / Beta 2 Microglobulin Mouse Monoclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal B2M Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen B2M antibody was raised against a 15 amino acid peptide near the carboxy terminus of human B2M.

Rabbit Polyclonal CREB Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human CREB.

Rabbit anti-TAPBP Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human TAPBP

Rabbit Polyclonal Calnexin Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Chicken, Avian, Drosophila
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of the canine Calnexin protein (within residues 25-100). [Swiss-Prot P24643]

Rabbit Polyclonal HSP70/HSPA1A Antibody

Applications FC, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human Hsp70 protein (between residues 550-600) [UniProt P08107]

HSP70-1A (HSPA1A) mouse monoclonal antibody, clone 4E7, Purified

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated

HSP70-1A (HSPA1A) mouse monoclonal antibody, clone 4E7, Purified

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated

Cathepsin L (CTSL) mouse monoclonal antibody, clone CP-L14, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat

CD4 mouse monoclonal antibody, clone B-A1, Purified

Applications FC, IHC
Reactivities Human

CREB1 mouse monoclonal antibody, clone 5F2, Purified

Applications ELISA, IHC, WB
Reactivities Human

HSP70-1A (HSPA1A) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 20-70 of Human HSP 70.

LTA (Center) rabbit polyclonal antibody

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 46-72 amino acids from the Central region of Human LTA.

HLA-DOA rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human

CREB1 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat

HSP90AA1 rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse, Rabbit, Rat
Immunogen Recombinant human Hsp90 R protein

CIITA (N-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide - KLH conjugated

KIR2DL4 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 302~332 amino acids from the C-terminal region of human CD158d / KIR2DL4

KIR3DL3 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 138~167 amino acids from the Center region of human KIR3DL3

CD8A mouse monoclonal antibody, clone LT8, Azide Free

Applications FC, IHC, IP
Reactivities Human

CD8A mouse monoclonal antibody, clone LT8, Purified

Applications FC, IHC, IP
Reactivities Human

CD8A mouse monoclonal antibody, clone LT8, Purified

Applications FC, IHC, IP
Reactivities Human

CD8A mouse monoclonal antibody, clone LT8, Purified

Applications FC, IHC, IP
Reactivities Human, Monkey

Rabbit Polyclonal Antibody against CD8A (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 150-180 amino acids from the C-terminal region of human CD8A.

Rabbit polyclonal antibody to HLA-DMB (major histocompatibility complex, class II, DM beta)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 199 and 263 of HLA-DMB (Uniprot ID#P28068)

Rabbit Polyclonal antibody to PSME3 (proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki))

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 254 of PSME3

Rabbit Polyclonal antibody to interferon alpha 2 (interferon, alpha 2)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 125 and 188 of Interferon alpha 2 (Uniprot ID#P01563)

Rabbit polyclonal HSP90B (Ser254) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human HSP90B around the phosphorylation site of serine 254 (V-G-SP-D-E).
Modifications Phospho-specific

Rabbit polyclonal CREB (Ser133) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CREB around the phosphorylation site of serine 133 (R-P-SP-Y-R).
Modifications Phospho-specific

Rabbit Polyclonal CIITA Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CIITA antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human CIITA.

Rabbit polyclonal HSP90AB1 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HSP90AB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 697-724 amino acids from the C-terminal region of human HSP90AB1.

Rabbit polyclonal HSP90AB1 Antibody (Center)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HSP90AB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 438-465 amino acids from the Central region of human HSP90AB1.

Rabbit polyclonal HLA-B Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HLA-B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-90 amino acids from the N-terminal region of human HLA-B.

Mouse Monoclonal Anti-Grp78 Antibody

Applications IHC, WB
Reactivities Human. Other species not yet tested
Conjugation Unconjugated

Rabbit anti-PDIA3 PPolyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PDIA3

Rabbit polyclonal Anti-HLA-F Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HLA-F antibody: synthetic peptide directed towards the N terminal of human HLA-F. Synthetic peptide located within the following region: EAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADT

Rabbit Polyclonal Anti-TAP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TAP1 Antibody: synthetic peptide directed towards the middle region of human TAP1. Synthetic peptide located within the following region: LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGL

Rabbit Polyclonal Cathepsin B Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of the human NFkB p65 protein (between residues 200-270) [UniProt P07858]

Rabbit Polyclonal HSP90 beta Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human Hsp90B protein (between residues 650-724) [UniProt P08238]

Rabbit Polyclonal HSP90 alpha Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human Hsp90A protein (between residues 650-732) [UniProt P07900]