Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal Calmodulin (Thr79+Ser81) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Calmodulin around the phosphorylation site of threonine 79 and serine 81 (K-D-TP-D-SP-E-E). |
| Modifications | Phospho-specific |
Rabbit polyclonal Raf1 (Ab-621) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human RAF1 around the phosphorylation site of serine 621 (S-A-S-E-P). |
Rabbit polyclonal PKA alpha/beta CAT (Thr197) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKA a/β CAT around the phosphorylation site of threonine 197 (T-W-TP-L-C). |
| Modifications | Phospho-specific |
MEK1 (MAP2K1) (N-term) rabbit polyclonal antibody, Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Xenopus |
| Immunogen | MAP2K1 antibody was raised against synthetic peptide derived from sequence near the amino-terminus of human MEK1, conjugated to KLH |
SCF (KITLG) mouse monoclonal antibody, clone hKL12, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Primate |
SCF (KITLG) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Immunogen | Highly pure (>98%) recombinant hSCF (anti-hSCF). |
SCF (KITLG) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Immunogen | Highly pure (>98%) recombinant hSCF. |
Mouse Monoclonal anti-CAMK2A Antibody
| Applications | IHC |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal Raf1 (Tyr341) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Raf1 around the phosphorylation site of tyrosine 341 (S-Y-YP-W-E). |
| Modifications | Phospho-specific |
Rabbit polyclonal CaMK2-beta/gamma/delta (Thr287) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CaMK2-β/?/d around the phosphorylation site of threonine 287 (Q-E-TP-V-E). |
| Modifications | Phospho-specific |
WNT2B Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | WNT2B antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT2B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Hamster, Panda, Horse, Rabbit, Pig (100%); Elephant (94%); Opossum, Platypus (88%). |
GSK3B / GSK3 Beta Rabbit Polyclonal (pSer9) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | GSK3B / GSK3 Beta antibody was raised against synthetic peptide from human GSK3B / GSK3 Beta. |
GNAS Rabbit Polyclonal (aa385-394) Antibody
| Applications | IHC |
| Reactivities | Human, Primate |
| Conjugation | Unconjugated |
| Immunogen | GNAS antibody was raised against synthetic peptide from human GNAS. |
Rabbit polyclonal DVL1 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This DVL1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 442-470 amino acids from the Central region of human DVL1. |
Rabbit Polyclonal Anti-TYRP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TYRP1 antibody: synthetic peptide directed towards the middle region of human TYRP1. Synthetic peptide located within the following region: NDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWP |
Rabbit Polyclonal Anti-WNT10B Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT10B antibody: synthetic peptide directed towards the middle region of human WNT10B. Synthetic peptide located within the following region: GTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLR |
Rabbit Polyclonal Anti-FZD5 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD5 antibody: synthetic peptide directed towards the middle region of human FZD5. Synthetic peptide located within the following region: CYLYEQHYRESWEAALTCACPGHDTGQPRAKPEYWVLMLKYFMCLVVGIT |
Rabbit Polyclonal Anti-WNT7B Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT7B antibody: synthetic peptide directed towards the middle region of human WNT7B. Synthetic peptide located within the following region: WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM |
beta Catenin (CTNNB1) mouse monoclonal antibody, clone IMD-110, Purified
| Applications | IF, IHC, WB |
| Reactivities | Chicken, Human, Rat |
USD 480.00
2 Weeks
USD 805.00
2 Weeks
Endothelin 1 (EDN1) (C-term) mouse monoclonal antibody, clone 1C4, Purified
| Applications | ELISA, IHC, R |
| Reactivities | Human |
Endothelin 1 (EDN1) sheep polyclonal antibody, Purified
| Applications | ELISA, IHC, R |
| Reactivities | Human |
| Immunogen | Human Endothelin, KLH conjugated |
Active filters
Applications
- IHC
Pathways
- Melanogenesis
Filter by
Category
Target Symbol
- MAP2K1 (183)
- CTNNB1 (83)
- KIT (58)
- GNAS (32)
- MAPK1 (29)
- HRAS (27)
- POMC (23)
- WNT3 (22)
- MAP2K2 (19)
- DVL2 (17)
- KITLG (16)
- CREB1 (15)
- RAF1 (11)
- TYR (11)
- CAMK2B (10)
- MITF (10)
- GSK3B (9)
- PRKCA (9)
- MAPK3 (8)
- NRAS (8)
- EDN1 (7)
- EP300 (7)
- LEF1 (7)
- CAMK2A (6)
- WNT10B (6)
- WNT2B (6)
- WNT3A (6)
- CREBBP (5)
- WNT1 (5)
- WNT10A (5)
- DCT (4)
- FZD2 (4)
- FZD8 (4)
- PLCB3 (4)
- WNT5B (4)
- ADCY1 (3)
- ADCY5 (3)
- BMP2 (3)
- FZD4 (3)
- FZD9 (3)
- GNAI1 (3)
- MC1R (3)
- WNT11 (3)
- WNT16 (3)
- WNT2 (3)
- WNT5A (3)
- WNT6 (3)
- WNT8A (3)
- WNT9A (3)
- WNT9B (3)
- ADCY4 (2)
- CREB3L1 (2)
- EDNRB (2)
- FZD1 (2)
- FZD3 (2)
- FZD5 (2)
- FZD6 (2)
- GNAO1 (2)
- PRKACA (2)
- PRKACG (2)
- PRKCB (2)
- PRKX (2)
- TCF7 (2)
- WNT4 (2)
- WNT7A (2)
- WNT8B (2)
- ADCY3 (1)
- ADCY6 (1)
- ADCY7 (1)
- ADCY8 (1)
- CALM1 (1)
- CALM2 (1)
- CALML5 (1)
- CAMK2G (1)
- CREB3L2 (1)
- CREB3L4 (1)
- DVL1 (1)
- DVL3 (1)
- FZD10 (1)
- FZD7 (1)
- GNAI3 (1)
- PLCB1 (1)
- PLCB2 (1)
- PRKACB (1)
- PRKCG (1)
- TCF7L1 (1)
- TYRP1 (1)
- WNT7B (1)
Reactivities
- Human (669)
- Mouse (514)
- Rat (492)
- Dog (254)
- Monkey (239)
- Bovine (24)
- Rabbit (13)
- Gorilla (12)
- Hamster (12)
- Bat (11)
- Horse (11)
- Pig (11)
- Gibbon (10)
- Chicken (8)
- Xenopus (6)
- Primate (4)
- Chimpanzee (2)
- Guinea Pig (2)
- Porcine (2)
- Rhesus Monkey (2)
- Canine (1)
- Cow (1)
- Fish (1)
- Orang-Utan (1)
- Sheep (1)
- X. tropicalis (1)
- Zebrafish (1)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (720)
- Protein Kinase (353)
- ES Cell Differentiation/IPS (215)
- Transmembrane (186)
- Transcription Factors (129)
- Secreted Protein (127)
- Adult stem cells (89)
- Embryonic stem cells (61)
- Stem cell - Pluripotency (58)
- Cancer stem cells (29)
- Stem cell relevant signaling - Wnt Signaling pathway (26)
- GPCR (24)
- Induced pluripotent stem cells (12)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (3)