Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Collagen I (COL1A1) rabbit polyclonal antibody, Biotin
| Applications | ELISA, FC, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian, Mouse, Rat |
| Conjugation | Biotin |
| Immunogen | Collagen Type I from Human and Bovine placenta. |
CD61 (ITGB3) mouse monoclonal antibody, clone VIPL2, Aff - Purified
| Applications | FC, IHC, WB |
| Reactivities | Human, Primate |
USD 525.00
5 Days
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Human |
| Immunogen | Purified Collagen type I from Human skin. |
Syndecan 1 (SDC1) mouse monoclonal antibody, clone B-A38, Azide Free
| Applications | FC, IHC |
| Reactivities | Human |
Collagen IV (COL4A1) rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, WB |
| Reactivities | Canine, Feline, Fish, Human, Mouse, Porcine, Rat |
| Immunogen | Human placental type IV Collagen. |
Rabbit polyclonal Syndecan4 (Ab-179) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Syndecan4 around the phosphorylation site of serine 179 (E-G-SP-Y-D). |
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Porcine |
| Immunogen | Purified Collagen type I from Porcine tendon. |
Collagen V (COL5A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian |
| Immunogen | Collagen type V purified from Human and Bovine placenta |
Rabbit Polyclonal antibody to Laminin beta 3 (laminin, beta 3)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 644 and 960 of Laminin beta 3 (Uniprot ID#Q13751) |
Rabbit anti-GP9 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GP9 |
Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514) |
TMEM16A (ANO1) mouse monoclonal antibody, clone DOG1.1, Supernatant
| Applications | IHC |
| Reactivities | Human |
Collagen I (COL1A1) rabbit polyclonal antibody, Azide Free
| Applications | ELISA, IF, IHC |
| Reactivities | Fish |
| Immunogen | Collagen Type I extracted and purified from salmon fish skin. |
Rabbit Polyclonal Anti-COL1A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COL1A1 antibody: synthetic peptide directed towards the C terminal of human COL1A1. Synthetic peptide located within the following region: PPGPPSAGFDFSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKS |
Collagen IV (COL4A1) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Bovine, Human |
| Immunogen | Collagen Type IV from Human and Bovine placenta. |
Rabbit polyclonal ITGB4 (Ab-1510) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human ITGB4 around the phosphorylation site of tyrosine 1510 (R-D-YP-S-T). |
Collagen VI (COL6A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Bovine, Chicken, Human, Mouse, Porcine, Rat |
| Immunogen | Purified collagen type VI from human placenta. |
ITGAV Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human ITGAV |
Syndecan 1 (SDC1) mouse monoclonal antibody, clone B-A38, Biotin
| Applications | FC, IHC |
| Reactivities | Human |
| Conjugation | Biotin |
Laminin alpha 5 (LAMA5) mouse monoclonal antibody, clone 4B12, Purified
| Applications | ELISA, IF, IHC, IP |
| Reactivities | Human |
Collagen III (COL3A1) mouse monoclonal antibody, clone 8D1-8C7, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Human |
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Bonito, Salmon, Sole, Tuna |
| Immunogen | Purified Collagen type I from Salmon skin |
Collagen IV (COL4A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Porcine |
| Immunogen | Purified collagen type IV from porcine renals. |
Collagen VI (COL6A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian |
| Immunogen | Collagen type VI purified from Human and Bovine placenta. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- IHC
Pathways
- ECM-receptor interaction
Filter by
Target Symbol
- CD44 (47)
- VWF (47)
- COL1A1 (24)
- SDC1 (24)
- LAMB3 (22)
- ITGB3 (21)
- FN1 (19)
- SPP1 (18)
- COL4A1 (15)
- CD36 (13)
- CD47 (12)
- COL5A1 (9)
- COL6A1 (9)
- LAMA4 (9)
- ITGA6 (8)
- ITGB1 (6)
- COL3A1 (5)
- ITGA3 (5)
- LAMB2 (5)
- COL2A1 (4)
- ITGA4 (4)
- ITGB4 (4)
- THBS1 (4)
- COL1A2 (3)
- HMMR (3)
- ITGA2 (3)
- ITGA2B (3)
- LAMA1 (3)
- LAMA5 (3)
- LAMB1 (3)
- TNC (3)
- TNXB (3)
- VTN (3)
- AGRN (2)
- COL4A2 (2)
- COL5A2 (2)
- ITGA5 (2)
- ITGA7 (2)
- ITGAV (2)
- LAMA3 (2)
- TNN (2)
- TNR (2)
- COL11A2 (1)
- COL4A4 (1)
- COL4A6 (1)
- COL5A3 (1)
- COL6A2 (1)
- COL6A3 (1)
- COMP (1)
- GP1BA (1)
- GP1BB (1)
- GP6 (1)
- GP9 (1)
- HSPG2 (1)
- IBSP (1)
- ITGA1 (1)
- ITGA11 (1)
- ITGA8 (1)
- ITGB5 (1)
- ITGB6 (1)
- ITGB7 (1)
- LAMA2 (1)
- LAMC1 (1)
- LAMC3 (1)
- SDC4 (1)
- SV2A (1)
- THBS2 (1)