Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-RAD51 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RAD51 Antibody: synthetic peptide directed towards the N terminal of human RAD51. Synthetic peptide located within the following region: ANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKILVMAERYGLS |
RAD51C rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human |
Rabbit polyclonal Bloom Syndrome Protein (Thr99)(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Bloom Syndrome Protein around the phosphorylation site of threonine 99 (Q-E-TP-Q-R). |
| Modifications | Phospho-specific |
Rabbit polyclonal antibody to RPA 32 kDa subunit (replication protein A2, 32kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 202 of RPA32 (Uniprot ID#P15927) |
Rabbit polyclonal anti-XRCC2 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human XRCC2. |
RAD51 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminal of human RAD51A |
Rabbit polyclonal RFA2 (Thr21) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human RFA2 around the phosphorylation site of threonine 21 (G-Y-TP-Q-S). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-RAD54B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAD54B antibody: synthetic peptide directed towards the N terminal of human RAD54B. Synthetic peptide located within the following region: DAVLIVKGKSFILKNLEGKDIGRGIGYKFKELEKIEEGQTLMICGKEIEV |
Rabbit Polyclonal Anti-RAD54B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAD54B antibody: synthetic peptide directed towards the middle region of human RAD54B. Synthetic peptide located within the following region: NSLKPLSMSQLKQWKHFSGDHLNLTDPFLERITENVSFIFQNITTQATGT |
Rabbit polyclonal anti-RAD54B antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RAD54B. |
Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI9A1 (formerly 9A1)
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI7C12 (formerly 7C12)
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI8B3 (formerly 8B3)
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Applications
- IHC
Pathways
- Homologous recombination