Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-PKLR Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PKLR antibody: synthetic peptide directed towards the N terminal of human PKLR. Synthetic peptide located within the following region: STSIIATIGPASRSVERLKEMIKAGMNIARLNFSHGSHEYHAESIANVRE |
Rabbit polyclonal NeuroD1 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NeuroD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 15-45 amino acids from the N-terminal region of human NeuroD1. |
HNF 4 alpha (HNF4A) (2-15) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Bat, Canine, Equine, Hamster, Human, Monkey, Porcine, Rabbit |
| Immunogen | Synthetic peptide from the N-terminus of human HNF4A / HNF4 (NP_849180.1; NP_000448.3; NP_849181.1) |
USD 475.00
5 Days
Insulin (INS) (+Proinsulin) mouse monoclonal antibody, clone D3E7 (5B6/6), Purified
| Applications | ELISA, IHC |
| Reactivities | Bovine, Human, Mouse, Porcine, Rat |
Rabbit polyclonal HNF4A Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | This HNF4A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 281-312 amino acids from the Central region of human HNF4A. |
GLUT2 Goat Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | SLC2A2 / GLUT2 antibody was raised against synthetic peptide C-RKEREEASSEQKVS from an internal region of human SLC2A2 / GLUT2 (NP_000331.1). Percent identity by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Marmoset, Panda, Bat, Rabbit, Horse, Pig (93%); Rat, Sheep, Elephant, Dog, Bovine (86%). |
Rabbit polyclonal GCK Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This GCK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human GCK. |
Rabbit Polyclonal Anti-FOXA3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXA3 antibody: synthetic peptide directed towards the middle region of human FOXA3. Synthetic peptide located within the following region: FENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPAATVTSP |
USD 475.00
5 Days
Insulin (INS) (+Proinsulin) mouse monoclonal antibody, clone 5E4/3 (D6C4), Purified
| Applications | ELISA, IHC |
| Reactivities | Bovine, Human, Mouse, Porcine, Rat |
Rabbit Polyclonal antibody to Pyruvate Kinase (liver/RBC) (pyruvate kinase, liver and RBC)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 260 of Pyruvate Kinase (liver/RBC) (Uniprot ID#P30613) |
Rabbit polyclonal FOXA2 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FOXA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 128-157 amino acids from the Central region of human FOXA2. |
Rabbit polyclonal FOXA2 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | This FOXA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 380-407 amino acids from the C-terminal region of human FOXA2. |
Rabbit Polyclonal anti-HHEX antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HHEX antibody: synthetic peptide directed towards the middle region of human HHEX. Synthetic peptide located within the following region: KQENPQSNKKEELESLDSSCDQRQDLPSEQNKGASLDSSQCSPSPASQED |
Rabbit Polyclonal Anti-HNF4A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNF4A antibody: synthetic peptide directed towards the middle region of human HNF4A. Synthetic peptide located within the following region: RGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEV |
Rabbit Polyclonal Anti-HNF1A
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNF1A antibody: synthetic peptide directed towards the N terminal of human HNF1A. Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE |
Insulin (INS) rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Bovine, Porcine, Rat |
| Conjugation | Unconjugated |
Insulin (INS) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Insulin (INS) (+Proinsulin) guinea pig polyclonal antibody, Serum
| Applications | IF, IHC |
| Reactivities | Hamster, Human, Porcine, Rat |
| Immunogen | Synthetic Human proinsulin |
Rabbit Polyclonal Anti-NKX2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NKX2-2 antibody: synthetic peptide directed towards the N terminal of human NKX2-2. Synthetic peptide located within the following region: MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQ |
Rabbit Polyclonal Anti-ONECUT1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ONECUT1 antibody: synthetic peptide directed towards the middle region of human ONECUT1. Synthetic peptide located within the following region: ITISQQLGLELSTVSNFFMNARRRSLDKWQDEGSSNSGNSSSSSSTCTKA |
Insulin (INS) mouse monoclonal antibody, clone ISL-8J, Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
HNF4G / HNF4 Gamma Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | HNF4G / HNF4 Gamma antibody was raised against synthetic 16 amino acid peptide from internal region of human HNF4G. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Mouse, Elephant, Panda, Dog (94%); Bat, Horse, Turkey, Chicken (88%); Rat, Pig, Opossum, Platypus (81%). |
Rabbit Polyclonal HES-1 Antibody
| Applications | IHC |
| Reactivities | Bovine, Human, Mouse, Primate, Rat |
| Conjugation | Unconjugated |
| Immunogen | A portion of amino acids 230-280 of human HES1 was used as the immunogen. |
Mouse anti Insulin Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human, Rat, Pig |
| Conjugation | Unconjugated |
Rabbit anti Amylin Peptide Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from N-term of human Amylin peptide. |
Active filters
Applications
- IHC
Pathways
- Maturity onset diabetes of the young
Filter by
Category
Target Symbol
Reactivities
Antibody Hosts
Isotypes
Clonalities
Conjugates
Families
- ES Cell Differentiation/IPS (96)
- Transcription Factors (86)
- Druggable Genome (79)
- Adult stem cells (32)
- Embryonic stem cells (29)
- Cancer stem cells (25)
- Stem cell relevant signaling - DSL/Notch pathway (25)
- Induced pluripotent stem cells (23)
- Nuclear Hormone Receptor (17)
- Secreted Protein (11)
- Transmembrane (3)