Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal IRAK-M Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Rabbit polyclonal IRS-1 (Ab-312) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human IRS-1 around the phosphorylation site of serine 312 (A-T-SP-P-A). |
Goat Polyclonal Anti-BDNF Antibody
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BDNF Antibody: Peptide with sequence ETKCNPMGYTKE, from the internal region of the protein sequence according to NP_001700.2; NP_001700.2; NP_733928.1; NP_733929.1; NP_733930.1; NP_733931.1. |
Rabbit polyclonal RIPK2 (Ser176) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human RIPK2 around the phosphorylation site of serine 176 (S-L-SP-Q-S). |
| Modifications | Phospho-specific |
BAX (3-16) mouse monoclonal antibody, clone 2D2, Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Monkey |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
BAX (3-16) mouse monoclonal antibody, clone 2D2, Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Monkey |
Rabbit polyclonal CaMKII (Thr305) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CaMKII around the phosphorylation site of threonine 305 (I-L-TP-T-M). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Antibody against MAP3K5 (S83)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ASK1(MEKK5/MAP3K5) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 61-90 amino acids from human ASK1(MEKK5/MAP3K5). |
Rabbit Polyclonal Antibody against PIK3CA (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KCA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 504-533 amino acids from the Central region of human PI3KCA. |
Rabbit polyclonal MAP2K7 (Ser271) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAP2K7 around the phosphorylation site of serine 271 (V-D-SP-K-A). |
| Modifications | Phospho-specific |
Active filters
Applications
- IHC
Pathways
- Neurotrophin signaling pathway
Filter by
Target Symbol
- MAP2K1 (183)
- TP53 (149)
- AKT1 (73)
- JUN (67)
- BCL2 (62)
- PIK3CG (54)
- PIK3R5 (37)
- IRS1 (34)
- TP73 (31)
- BRAF (30)
- MAPK1 (29)
- MAPK9 (28)
- PIK3CD (28)
- HRAS (27)
- MAPK8 (26)
- RELA (24)
- PIK3CA (23)
- BAX (22)
- FOXO3 (19)
- MAP2K2 (19)
- MAPK13 (19)
- BAD (17)
- NTF3 (17)
- SHC1 (16)
- NFKBIA (15)
- NTRK3 (15)
- RAPGEF1 (15)
- AKT2 (13)
- MAPK14 (13)
- ABL1 (12)
- AKT3 (11)
- NTRK2 (11)
- RAF1 (11)
- CAMK2B (10)
- IRAK1 (10)
- MAP3K5 (10)
- NTRK1 (10)
- BDNF (9)
- GSK3B (9)
- NFKB1 (9)
- NFKBIE (9)
- NGFR (9)
- PIK3R1 (9)
- MAPK3 (8)
- NRAS (8)
- YWHAB (8)
- IRAK2 (7)
- NTF4 (7)
- RPS6KA1 (7)
- ARHGDIA (6)
- CAMK2A (6)
- FASLG (6)
- GRB2 (6)
- MAPK12 (6)
- MAPKAPK2 (6)
- PRKCD (6)
- PTPN11 (6)
- YWHAQ (6)
- YWHAZ (6)
- IKBKB (5)
- NGF (5)
- RPS6KA5 (5)
- SH2B3 (5)
- TRAF6 (5)
- ATF4 (4)
- CAMK4 (4)
- CRK (4)
- CRKL (4)
- NFKBIB (4)
- YWHAE (4)
- YWHAG (4)
- IRS2 (3)
- MAGED1 (3)
- PLCG1 (3)
- PSEN1 (3)
- RIPK2 (3)
- RPS6KA6 (3)
- SORT1 (3)
- BEX3 (2)
- CSK (2)
- FRS2 (2)
- IRAK3 (2)
- IRAK4 (2)
- MAPK7 (2)
- PIK3R3 (2)
- RAC1 (2)
- RAP1A (2)
- RAP1B (2)
- RHOA (2)
- RPS6KA2 (2)
- RPS6KA3 (2)
- YWHAH (2)
- ARHGDIB (1)
- CALM1 (1)
- CALM2 (1)
- CALML5 (1)
- CAMK2G (1)
- CDC42 (1)
- GAB1 (1)
- IRS4 (1)