Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
USD 240.00
2 Weeks
PDGF Receptor beta (PDGFRB) mouse monoclonal antibody, clone 18A2, Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
Rabbit Polyclonal Anti-PDGFB Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDGFB antibody: synthetic peptide directed towards the N terminal of human PDGFB. Synthetic peptide located within the following region: NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD |
Rabbit Polyclonal Antibody against PIK3CA (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KCA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 504-533 amino acids from the Central region of human PI3KCA. |
Rabbit polyclonal IGF1R (Tyr1346) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IGF1R around the phosphorylation site of tyrosine 1346 (Q-P-YP-A-H). |
| Modifications | Phospho-specific |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
PDGF Receptor alpha (PDGFRA) (1035-1053) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide KLH-conjugated corresponding to amino acids 1000 to the C-term of Human PDGF |
Active filters
Applications
- IHC
Pathways
- Prostate cancer
Filter by
Target Symbol
- MAP2K1 (183)
- TP53 (149)
- ERBB2 (108)
- CTNNB1 (83)
- AKT1 (73)
- NKX3-1 (73)
- BCL2 (62)
- EGFR (59)
- PIK3CG (54)
- MTOR (51)
- MDM2 (48)
- KLK3 (38)
- PIK3R5 (37)
- AR (30)
- BRAF (30)
- MAPK1 (29)
- PIK3CD (28)
- HRAS (27)
- RB1 (27)
- RELA (24)
- PIK3CA (23)
- FGFR2 (22)
- CDKN1A (21)
- MAP2K2 (19)
- BAD (17)
- PDGFRA (17)
- PDGFRB (17)
- EGF (16)
- FOXO1 (16)
- GSTP1 (16)
- IGF1 (16)
- CREB1 (15)
- NFKBIA (15)
- CASP9 (14)
- AKT2 (13)
- CHUK (13)
- IKBKG (13)
- AKT3 (11)
- ARAF (11)
- HSP90AA1 (11)
- HSP90AB1 (11)
- RAF1 (11)
- HSP90B1 (10)
- GSK3B (9)
- INS (9)
- NFKB1 (9)
- PIK3R1 (9)
- FGFR1 (8)
- MAPK3 (8)
- NRAS (8)
- PTEN (8)
- CCND1 (7)
- EP300 (7)
- LEF1 (7)
- PDGFB (7)
- CCNE1 (6)
- CDKN1B (6)
- GRB2 (6)
- PDGFA (6)
- CREBBP (5)
- IGF1R (5)
- IKBKB (5)
- ATF4 (4)
- PDPK1 (4)
- CCNE2 (3)
- E2F1 (3)
- TGFA (3)
- CDK2 (2)
- CREB3L1 (2)
- E2F2 (2)
- PIK3R3 (2)
- TCF7 (2)
- CREB3L2 (1)
- CREB3L4 (1)
- E2F3 (1)
- PDGFC (1)
- PIK3CB (1)
- PIK3R2 (1)
- SRD5A2 (1)
- TCF7L1 (1)
Reactivities
- Human (1505)
- Mouse (1117)
- Rat (1076)
- Monkey (355)
- Dog (317)
- Bovine (14)
- Chicken (10)
- Pig (10)
- Primate (8)
- Rabbit (7)
- Cow (5)
- Xenopus (5)
- Rhesus Monkey (4)
- Hamster (3)
- Canine (2)
- Gerbil (2)
- Zebrafish (2)
- Bat (1)
- Chimpanzee (1)
- Equine (1)
- Fungi (1)
- Horse (1)
- Insect (1)
- Plant (1)
- Porcine (1)
- X. tropicalis (1)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (1723)
- Protein Kinase (708)
- Transcription Factors (529)
- ES Cell Differentiation/IPS (448)
- Transmembrane (318)
- Stem cell - Pluripotency (249)
- Secreted Protein (147)
- Adult stem cells (83)
- Stem cell relevant signaling - JAK/STAT signaling pathway (66)
- Cancer stem cells (59)
- Protease (52)
- Nuclear Hormone Receptor (30)
- Embryonic stem cells (17)
- Induced pluripotent stem cells (17)
- Stem cell relevant signaling - DSL/Notch pathway (13)
- Phosphatase (8)
- Stem cell relevant signaling - Wnt Signaling pathway (7)