Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
Rabbit Polyclonal Antibody against PIK3CA (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KCA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 504-533 amino acids from the Central region of human PI3KCA. |
Rabbit polyclonal MAP2K7 (Ser271) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAP2K7 around the phosphorylation site of serine 271 (V-D-SP-K-A). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Antibody against CD8A (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 59-88 amino acids from the N-terminal region of human CD8A. |
Rabbit Polyclonal Anti-NFATC2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFATC2 antibody: synthetic peptide directed towards the C terminal of human NFATC2. Synthetic peptide located within the following region: PTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDDVNE |
Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C). |
| Modifications | Phospho-specific |
Rabbit polyclonal p38 MAPK (Ab-322) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human p38 MAPK around the phosphorylation site of tyreonine 322 (D-P-Y-D-Q). |
Rabbit Polyclonal Antibody against PIK3R1 (N-term L11)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human PI3KR1. |
Rabbit Polyclonal Antibody against AKT2 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This AKT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-123 amino acids from the N-terminal region of human AKT2. |
Rabbit polyclonal antibody to MALT1 (mucosa associated lymphoid tissue lymphoma translocation gene 1)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 341 and 609 of MALT1 (Uniprot ID#Q9UDY8) |
Rabbit polyclonal COT (Ab-290) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human COT around the phosphorylation site of threonine 290 (R-G-TP-E-I). |
Rabbit polyclonal CDK4 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CDK4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 273-305 amino acids from the C-terminal region of human CDK4. |
Rabbit anti-CDC42 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CDC42 |
Active filters
Reactivities
- Human
Applications
- IHC
Pathways
- T cell receptor signaling pathway
Filter by
Target Symbol
- MAP2K1 (173)
- CD4 (79)
- JUN (66)
- AKT1 (65)
- PTPRC (63)
- PDCD1 (54)
- PIK3CG (54)
- FOS (41)
- BCL10 (36)
- PIK3R5 (36)
- MAPK1 (29)
- PIK3CD (28)
- HRAS (27)
- MAPK9 (27)
- PIK3CA (22)
- CSF2 (21)
- CD8A (18)
- MALT1 (18)
- MAP2K2 (18)
- CHP1 (17)
- TNF (17)
- MAPK13 (16)
- RELA (16)
- NFKBIA (13)
- IL2 (12)
- CTLA4 (11)
- AKT2 (10)
- IKBKG (10)
- AKT3 (9)
- CD3E (9)
- MAP3K8 (9)
- NFKBIE (9)
- NRAS (8)
- PAK1 (8)
- CHUK (7)
- GSK3B (7)
- MAPK3 (7)
- NFKB1 (7)
- PAK4 (7)
- GRAP2 (6)
- MAPK12 (6)
- MAPK14 (6)
- PPP3CA (6)
- PRKCQ (6)
- IKBKB (5)
- RAF1 (5)
- ZAP70 (5)
- NFKBIB (4)
- PAK2 (4)
- PIK3R1 (4)
- PTPN6 (4)
- CARD11 (3)
- CD247 (3)
- CDK4 (3)
- FYN (3)
- GRB2 (3)
- IFNG (3)
- MAP3K14 (3)
- MAP3K7 (3)
- NFATC4 (3)
- PAK5 (3)
- CD3D (2)
- IL4 (2)
- LCK (2)
- NCK1 (2)
- NCK2 (2)
- NFATC1 (2)
- NFATC2 (2)
- NFATC3 (2)
- PAK3 (2)
- PIK3R3 (2)
- PLCG1 (2)
- CBL (1)
- CBLC (1)
- CDC42 (1)
- ICOS (1)
- IL10 (1)
- IL5 (1)
- ITK (1)
- MAP2K7 (1)
- MAPK11 (1)
- NFAT5 (1)
- PAK6 (1)
- PIK3CB (1)
- PIK3R2 (1)
- PPP3CB (1)
- TEC (1)
- VAV1 (1)
- VAV2 (1)