Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-SMURF2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SMURF2 antibody was raised against a 17 amino acid peptide near the amino terminus of human SMURF2. The immunogen is located within amino acids 140 - 190 of SMURF2. |
Rabbit Polyclonal Anti-FZD7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD7 antibody: synthetic peptide directed towards the C terminal of human FZD7. Synthetic peptide located within the following region: PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, HRP
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | HRP |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit Polyclonal Anti-WNT2B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide directed towards the middle region of human WNT2B. Synthetic peptide located within the following region: LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, AP
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | AP |
Rabbit polyclonal CaMKII (Thr305) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CaMKII around the phosphorylation site of threonine 305 (I-L-TP-T-M). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-FZD9 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD9 antibody: synthetic peptide directed towards the N terminal of human FZD9. Synthetic peptide located within the following region: RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF |
Rabbit Polyclonal Anti-WNT3A Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT3A antibody: synthetic peptide directed towards the N terminal of human WNT3A. Synthetic peptide located within the following region: MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP |
Frizzled 2 (FZD2) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_001457.1. |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-WNT2B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide directed towards the middle region of human WNT2B. Synthetic peptide located within the following region: LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT |
Rabbit polyclonal SMAD3-S208 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3. |
Rabbit Polyclonal Anti-NFATC2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFATC2 antibody: synthetic peptide directed towards the C terminal of human NFATC2. Synthetic peptide located within the following region: PTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDDVNE |
Rabbit Polyclonal Anti-WNT9B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT9B antibody: synthetic peptide directed towards the C terminal of human WNT9B. Synthetic peptide located within the following region: FRETGQVLKLRYDSAVKVSSATNEALGRLELWAPARQGSLTKGLAPRSGD |
Rabbit Polyclonal Anti-FZD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD4 antibody: synthetic peptide directed towards the middle region of human FZD4. Synthetic peptide located within the following region: GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV |
Rabbit Polyclonal Anti-WNT2B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT2B antibody: synthetic peptide directed towards the N terminal of human WNT2B. Synthetic peptide located within the following region: LRPGGAEEAAQLPLRRASAPVPVPSPAAPDGSRASARLGLACLLLLLLLT |
Rabbit Polyclonal Anti-NKD1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NKD1 antibody: synthetic peptide directed towards the N terminal of human NKD1. Synthetic peptide located within the following region: ELVGDVLRDTLSEEEEDDFRLEVALPPEKTDGLGSGDEKKMERVSEPCPG |
Rabbit Polyclonal antibody to WNT11 (wingless-type MMTV integration site family, member 11)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 310 of WNT11 (Uniprot ID#O96014) |
Rabbit polyclonal WNT5B Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This WNT5B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 153-182 amino acids from the Central region of human WNT5B. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- IHC
Pathways
- Wnt signaling pathway
Filter by
Target Symbol
- TP53 (149)
- CTNNB1 (83)
- JUN (67)
- SENP2 (64)
- MYC (32)
- MAPK9 (28)
- MAPK8 (26)
- MMP7 (22)
- WNT3 (22)
- CHP1 (17)
- DVL2 (17)
- APC (15)
- CSNK1E (12)
- CTBP2 (12)
- SMAD3 (12)
- SOX17 (12)
- CAMK2B (10)
- PPARD (10)
- PPP2R5D (10)
- PPP3CA (10)
- SFRP2 (10)
- GSK3B (9)
- PRKCA (9)
- PPP2R1B (8)
- CCND1 (7)
- EP300 (7)
- FOSL1 (7)
- LEF1 (7)
- ROCK2 (7)
- CAMK2A (6)
- SFRP1 (6)
- SMAD2 (6)
- WNT10B (6)
- WNT2B (6)
- WNT3A (6)
- CREBBP (5)
- CTBP1 (5)
- NFATC4 (5)
- SIAH1 (5)
- WNT1 (5)
- WNT10A (5)
- CCND3 (4)
- CSNK1A1 (4)
- CSNK2A1 (4)
- CUL1 (4)
- DKK1 (4)
- FZD2 (4)
- FZD8 (4)
- MAP3K7 (4)
- NFATC1 (4)
- PLCB3 (4)
- PPP2R1A (4)
- ROCK1 (4)
- SMAD4 (4)
- WNT5B (4)
- AXIN1 (3)
- AXIN2 (3)
- FZD4 (3)
- FZD9 (3)
- LRP5 (3)
- LRP6 (3)
- PPP2CA (3)
- PSEN1 (3)
- SKP1 (3)
- WNT11 (3)
- WNT16 (3)
- WNT2 (3)
- WNT5A (3)
- WNT6 (3)
- WNT8A (3)
- WNT9A (3)
- WNT9B (3)
- APC2 (2)
- CCND2 (2)
- CXXC4 (2)
- FZD1 (2)
- FZD3 (2)
- FZD5 (2)
- FZD6 (2)
- NFATC2 (2)
- NFATC3 (2)
- NLK (2)
- PPP2CB (2)
- PPP3CC (2)
- PRKACA (2)
- PRKACG (2)
- PRKCB (2)
- PRKX (2)
- RAC1 (2)
- RHOA (2)
- TBL1X (2)
- TBL1XR1 (2)
- TCF7 (2)
- VANGL1 (2)
- WIF1 (2)
- WNT4 (2)
- WNT7A (2)
- WNT8B (2)
- BTRC (1)
- CAMK2G (1)
Reactivities
- Human (805)
- Mouse (603)
- Rat (551)
- Monkey (146)
- Dog (108)
- Bovine (31)
- Pig (19)
- Rabbit (16)
- Chicken (15)
- Gorilla (12)
- Hamster (12)
- Bat (11)
- Horse (11)
- Xenopus (11)
- Gibbon (10)
- Primate (6)
- Zebrafish (6)
- Cow (5)
- X. tropicalis (4)
- Canine (2)
- Guinea Pig (2)
- Chimpanzee (1)
- Fish (1)
- Opossum (1)
- Orang-Utan (1)
- Porcine (1)
- Rhesus Monkey (1)
- Sheep (1)
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (847)
- Transcription Factors (438)
- ES Cell Differentiation/IPS (316)
- Stem cell - Pluripotency (201)
- Protein Kinase (140)
- Secreted Protein (111)
- Stem cell relevant signaling - Wnt Signaling pathway (95)
- Transmembrane (94)
- Protease (89)
- Cancer stem cells (59)
- Stem cell relevant signaling - JAK/STAT signaling pathway (57)
- Embryonic stem cells (50)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (50)
- Induced pluripotent stem cells (44)
- Adult stem cells (42)
- Phosphatase (41)
- GPCR (19)
- Nuclear Hormone Receptor (10)
- Stem cell relevant signaling - DSL/Notch pathway (7)