Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-GADD45B Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GADD45B antibody: synthetic peptide directed towards the middle region of human GADD45B. Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW |
BAX (3-16) mouse monoclonal antibody, clone 2D2, Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Monkey |
BAX (3-16) mouse monoclonal antibody, clone 2D2, Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Monkey |
Rabbit polyclonal p16-INK4a (Phospho-Ser152) antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human p16-INK4a around the phosphorylation site of serine 152 (G-P-SP-D-I). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-SERPINB5 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SERPINB5 antibody: synthetic peptide directed towards the middle region of human SERPINB5. Synthetic peptide located within the following region: NSVNDQTKILVVNAAYFVGKWMKKFPESETKECPFRLNKTDTKPVQMMNM |
Rabbit polyclonal CASP8 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CASP8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 432-461 amino acids from the C-terminal region of human CASP8. |
Cyclin D1 (CCND1) mouse monoclonal antibody, clone CD1.1
| Applications | ELISA, FC, IF, IHC, IP, WB |
| Reactivities | Human, Rat |
Rabbit polyclonal CDK4 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CDK4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 273-305 amino acids from the C-terminal region of human CDK4. |
Anti-Human IGF-I Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human IGF-I |
Phospho-CDK6-Y13 Rabbit Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y13 of human CDK6 |
| Modifications | Phospho-specific |
USD 300.00
2 Weeks
p53 (TP53) (Wild type + Mutant) (20-31) mouse monoclonal antibody, clone Bp53-11, Aff - Purified
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human |
Cytochrome C (CYCS) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminal of human Cytochrome C |
Rabbit Polyclonal Antibody against MDM2 (C-term)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This Mdm2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 393-424 amino acids from the C-terminal region of human Mdm2. |
Active filters
Applications
- IHC
Pathways
- p53 signaling pathway
Filter by
Category
Target Symbol
- TP53 (149)
- CDKN2A (91)
- MDM4 (56)
- MDM2 (48)
- CHEK2 (38)
- GADD45G (37)
- BID (36)
- TP73 (31)
- BAX (22)
- CASP3 (22)
- TNFRSF10B (22)
- CDKN1A (21)
- IGF1 (16)
- CASP9 (14)
- CCNB1 (12)
- RRM2 (12)
- APAF1 (11)
- CDK1 (8)
- CDK6 (8)
- PTEN (8)
- CCND1 (7)
- TP53I3 (7)
- ADGRB1 (6)
- CASP8 (6)
- CCNE1 (6)
- CHEK1 (6)
- SERPINB5 (6)
- SERPINE1 (6)
- ATM (5)
- SFN (5)
- SIAH1 (5)
- CCND3 (4)
- CYCS (4)
- THBS1 (4)
- TSC2 (4)
- BBC3 (3)
- CCNE2 (3)
- CD82 (3)
- CDK4 (3)
- FAS (3)
- IGFBP3 (3)
- SKP2 (3)
- ATR (2)
- CCNB2 (2)
- CCND2 (2)
- CDK2 (2)
- EI24 (2)
- GADD45A (2)
- GADD45B (2)
- PMAIP1 (2)
- SESN2 (2)
- SESN3 (2)
- TP53AIP1 (2)
- CCNG1 (1)
- CDC2 (1)
- GTSE1 (1)
- LRDD (1)
- PERP (1)
- RCHY1 (1)
- RRM2B (1)
- SESN1 (1)
- STEAP3 (1)
- ZMAT3 (1)
Reactivities
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (752)
- Transcription Factors (296)
- Stem cell - Pluripotency (248)
- Protein Kinase (73)
- Transmembrane (58)
- Protease (42)
- ES Cell Differentiation/IPS (41)
- Secreted Protein (39)
- Stem cell relevant signaling - DSL/Notch pathway (13)
- Phosphatase (8)
- Stem cell relevant signaling - JAK/STAT signaling pathway (7)
- Stem cell relevant signaling - Wnt Signaling pathway (7)