PPP4C Rabbit Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PPP4C |
PPP4C Rabbit Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PPP4C |
Goat Polyclonal Anti-CD45 Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 1,260 aa to the C-terminus of human CD45 produced in E. coli. |
Rabbit Polyclonal MKP-1/2 (Ser296/318) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human MKP-1/2 around the phosphorylation site of Serine 296/318 |
Modifications | Phospho-specific |
Rabbit anti-PPP1CB Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PPP1CB |
PTPN2 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PTPN2 |
Rabbit anti-PPP2R2A Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PPP2R2A |
Rabbit Polyclonal Anti-NDST2 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | NDST2 antibody was raised against a 16 amino acid peptide near the amino terminus of human NDST2 |
Rabbit anti-PTPN6 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PTPN6 |
Rabbit Polyclonal antibody to DUSP26 (dual specificity phosphatase 26 (putative))
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 22 and 117 of DUSP26 (Uniprot ID#Q9BV47) |
Goat Polyclonal Anti-DUSP6 / MKP3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-DUSP6 / MKP3 Antibody: Peptide with sequence C-PSNQNVYQVDSLQST, from the C Terminus of the protein sequence according to NP_001937.2; NP_073143.2. |
Rabbit Polyclonal antibody to PP1C gamma (protein phosphatase 1, catalytic subunit, gamma isozyme)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 2 and 227 of PP1C gamma (Uniprot ID#P36873) |
Anti-PTPRK Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
CDC25A Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CDC25A |
Rabbit anti-PPP1CA Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PPP1CA |
CDC25C Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CDC25C |
Rabbit anti-PPP2R1A Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PPP2R1A |
Rabbit anti-PPM1D Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PPM1D |
Goat Polyclonal Antibody against B56 beta isoform
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QRLTPQVAASGGQS, from the C Terminus of the protein sequence according to NP_006235.1. |
Rabbit Polyclonal SIRP alpha Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SIRP alpha antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human SIRP alpha 1? The sequences of the immunogenic peptide differ from those of mouse, rat and bovine by one amino acid. |
Rabbit polyclonal antibody to PSPH (phosphoserine phosphatase)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 175 of PSPH (Uniprot ID#P78330) |
Rabbit Polyclonal antibody to DUSP8 (dual specificity phosphatase 8)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 44 of DUSP8 (Uniprot ID#Q13202) |
Rabbit polyclonal PTEN (Ab-370) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This antiserum was produced against synthesized non-phosphopeptide derived from human PTEN around the phosphorylation site of serine 370. |
Rabbit polyclonal anti-PTPRZ1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human PTPRZ1. |
Rabbit polyclonal anti-PTPN22 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human PTPN22. |
Rabbit polyclonal anti-SSH3 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SSH3. |
Rabbit polyclonal anti-ILKAP antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ILKAP. |
Anti-PTEN (Phospho-Ser380/Thr382/Thr383) Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of threonine 380/382/383 (R-Y-S(p)-D-T(p)-T(p)-D-S) derived from Human PTEN. |
Modifications | Phospho-specific |
Rabbit polyclonal PTP4A2 Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This PTP4A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 32-59 amino acids from the Central region of human PTP4A2. |
Rabbit polyclonal CTDSP1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human CTDSP1. |
Rabbit Polyclonal Phospho-SHP-1 (Tyr536) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human SHP-1 around the phosphorylation site of Tyrosine 536 |
Modifications | Phospho-specific |
Rabbit Polyclonal PTP1B Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PTP1B |
Rabbit Polyclonal Anti-Ppp3cb Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Ppp3cb antibody is: synthetic peptide directed towards the middle region of Rat Ppp3cb. Synthetic peptide located within the following region: MCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLS |
Rabbit Polyclonal Anti-SHPS1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SHPS1 Antibody: A synthesized peptide derived from human SHPS1 |
Rabbit Polyclonal Anti-PTPN22 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PTPN22 Antibody: A synthesized peptide derived from human PTPN22 |
Rabbit Polyclonal Anti-ILKAP Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ILKAP Antibody: A synthesized peptide derived from human ILKAP |
Rabbit Polyclonal Anti-Phospho-CDC25A(Ser75) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Phospho-CDC25A(Ser75) Antibody: A synthesized peptide derived from human CDC25A around the phosphorylation site of Sersine 75 |
Modifications | Phospho-specific |
Goat Polyclonal Anti-CD45 Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 1,260 aa to the C-terminus of human CD45 produced in E. coli. |
Rabbit Polyclonal antibody to MTMR9 (myotubularin related protein 9)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 487 and 549 of MTMR9 (Uniprot ID#Q96QG7) |
Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298) |
Rabbit polyclonal CDC25B (Ser323) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CDC25B around the phosphorylation site of serine 323 (S-P-SP-M-P). |
Modifications | Phospho-specific |
Rabbit polyclonal CDC25A (Ab-178) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CDC25A around the phosphorylation site of serine 178 (Q-N-SP-A-P). |
Rabbit polyclonal anti-PPP2R5A antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PPP2R5A. |
Anti-PTP4A2 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 2-164 amino acids of human protein tyrosine phosphatase type IVA, member 2 |
Rabbit Polyclonal CDC25A (Ser124) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CDC25A around the phosphorylation site of Serine 124 |
Modifications | Phospho-specific |
Rabbit Polyclonal CDC25A (Ser178) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CDC25A around the phosphorylation site of Serine 178 |
Modifications | Phospho-specific |
Rabbit Polyclonal CDC25A (Ser75) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CDC25A around the phosphorylation site of Serine 75 |
Modifications | Phospho-specific |
Rabbit Polyclonal CDC25B Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CDC25B |
Rabbit Polyclonal CDC25B (Ser323) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CDC25B around the phosphorylation site of Serine 323 |
Modifications | Phospho-specific |
Rabbit Polyclonal MKP-1/2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human MKP-1/2 |
Rabbit Polyclonal CD45 (Ser1007) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CD45 around the phosphorylation site of Serine 1007 |
Modifications | Phospho-specific |