Germany
Japan
United Kingdom
China
Antibodies
Download
Goat Polyclonal Antibody against HSPA8 (Isoform 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EKLQGKINDEDKQK, from the internal region of the protein sequence according to NP_006588.1. |
Rabbit Polyclonal AurB (Thr232) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human AurB around the phosphorylation site of Threonine 232 |
| Modifications | Phospho-specific |
Rabbit Polyclonal DNMT3B Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DNMT3B antibody: mouse DNMT3B (DNA methyltransferase 3B), using a KLH-conjugated synthetic peptide containing a sequence from the N-terminal part of the protein |
Rabbit Polyclonal FKBP3 Antibody
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FKBP3 antibody: mouse FKBP3 (FK506 Binding Protein 3), using a KLH-conjugated synthetic peptide containing an amino acid sequence from the central part of the protein |
Rabbit Polyclonal MBD2 Antibody
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MBD2 antibody: mouse MBD2 (methyl-CpG binding domain protein 2), using a KLH-conjugated synthetic peptide containing an amino acid sequence from the central part of the protein |
Goat Polyclonal Anti-Histone Deacetylase 1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse (Expected from sequence similarity: Rat, Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Histone Deacetylase 1 Antibody: Peptide with sequence C-KPEAKGVKEEVK, from the C Terminus of the protein sequence according to NP_004955.2. |
Goat Polyclonal Antibody against PPID / CyP-40
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DENFHYKHDREG, from the internal region of the protein sequence according to NP_005029.1. |
Rabbit polyclonal Caspase 9 (Tyr153) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of tyrosine 153 (L-A-YP-I-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal HDAC2 Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HDAC2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 410-439 amino acids from the Central region of human HDAC2. |
Rabbit Polyclonal MYC Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MYC |
Rabbit polyclonal APOE antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human APOE. |
U2AF1 Rabbit Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human U2AF1 |
FBL Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Monkey, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FBL |
Rabbit polyclonal anti-PCNA antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PCNA |
Rabbit Polyclonal Anti-MBD2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MBD2 antibody: synthetic peptide directed towards the middle region of human MBD2. Synthetic peptide located within the following region: DCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNT |
Goat Polyclonal Anti-GNB2L1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GNB2L1 Antibody: Peptide with sequence NTLGVCKYTVQDESH, from the internal region of the protein sequence according to NP_006089.1. |
Goat Polyclonal Anti-cardiac troponin T Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Feline, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-cardiac troponin T Antibody: Peptide with sequence C-RNRINDNQKVSKT, from the C Terminus of the protein sequence according to NP_000355.2; NP_001001430.1; NP_001001431.1; NP_001001432.1. |
Goat Polyclonal Anti-MUTYH Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 476 aa to the C-terminus of human Mutyh produced in E. coli. |
Rabbit anti-ANXA2 (Annexin A2) polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | a 16 amino acid peptide from near the N terminal residues of human Annexin A2 protein |
Rabbit Polyclonal KPNA2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | KPNA2 antibody was raised against a 15 amino acid synthetic peptide near the amino terminus of human KPNA2. The immunogen is located within amino acids 40 - 90 of KPNA2. |
Rabbit polyclonal GOT2 Antibody (N-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GOT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-61 amino acids from the N-terminal region of human GOT2. |
Rabbit Polyclonal SirT1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SirT1 |
Rabbit anti-SFRS1 Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SFRS1 |
HDAC2 Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human HDAC2 |
Rabbit anti-PELP1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PELP1 |
Rabbit anti-SNRPE Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SNRPE |
Active filters
Category
- Antibodies
Reactivities
- Mouse
Applications
- WB
Conjugates
- Unconjugated
Families
- Stem cell - Pluripotency
Filter by
Target Symbol
- NME1 (99)
- PCNA (67)
- BCL2 (51)
- UNG (37)
- MCM2 (35)
- HSPD1 (34)
- PSMA6 (34)
- CHEK2 (33)
- TNNI3 (33)
- RBPMS (30)
- RPA2 (30)
- TP53 (29)
- HDAC1 (28)
- PPM1B (27)
- RFC2 (27)
- ERBB3 (26)
- MYC (26)
- PXN (26)
- VASP (26)
- EXOSC7 (21)
- TGIF1 (21)
- ANXA3 (19)
- TRIM28 (18)
- APEX1 (17)
- CCND1 (17)
- HDAC2 (17)
- HPRT1 (17)
- SIRT1 (17)
- FEN1 (16)
- HSP90AB1 (16)
- HSPA9 (16)
- PRMT5 (16)
- LCK (15)
- LSM1 (15)
- GEMIN2 (14)
- RFC3 (14)
- ATIC (13)
- CCNB1 (13)
- KPNB1 (13)
- OTX2 (13)
- PBX1 (13)
- STX3 (13)
- WDR77 (13)
- CTBP2 (12)
- PAK1 (12)
- PFN1 (12)
- SUPT3H (12)
- HSPA8 (11)
- PIAS2 (11)
- SUMO1 (11)
- CASP9 (10)
- CDK1 (10)
- COPS6 (10)
- PARP1 (10)
- PHGDH (10)
- CASP6 (9)
- DHFR (9)
- POU5F1 (9)
- SOCS1 (9)
- ACTA1 (8)
- BIRC5 (8)
- ANXA2 (7)
- CDC45 (7)
- GADD45A (7)
- HMGB1 (7)
- KIT (7)
- MSH6 (7)
- NFKBIB (7)
- RAD51 (7)
- ANP32A (6)
- CHEK1 (6)
- COPS3 (6)
- EXOSC3 (6)
- GRB7 (6)
- MBD2 (6)
- MPP6 (6)
- MRE11 (6)
- NPM1 (6)
- RND1 (6)
- TARBP2 (6)
- ARL4A (5)
- AURKA (5)
- BAK1 (5)
- CDK7 (5)
- DNMT3B (5)
- EWSR1 (5)
- FBL (5)
- GOT2 (5)
- HSPH1 (5)
- KPNA2 (5)
- MCM5 (5)
- MUTYH (5)
- PA2G4 (5)
- PHB (5)
- PTPN6 (5)
- SP1 (5)
- STIP1 (5)
- TK1 (5)
- TRIP13 (5)
- HSPE1 (4)
Antibody Hosts
Isotypes
Clonalities
Knockout (KO) Validation
Modifications
Assay Types
Pathways
- Cell cycle (331)
- Pathways in cancer (251)
- DNA replication (213)
- Metabolic pathways (175)
- Base excision repair (164)
- Nucleotide excision repair (160)
- Mismatch repair (157)
- Colorectal cancer (149)
- Small cell lung cancer (148)
- Focal adhesion (138)
- Purine metabolism (134)
- p53 signaling pathway (133)
- Chronic myeloid leukemia (129)
- Prostate cancer (126)
- MAPK signaling pathway (114)
- Pyrimidine metabolism (110)
- Apoptosis (99)
- RNA degradation (94)
- Amyotrophic lateral sclerosis (ALS) (92)
- Huntington's disease (90)
- Neurotrophin signaling pathway (87)
- Wnt signaling pathway (85)
- Endometrial cancer (82)
- Bladder cancer (72)
- Thyroid cancer (72)
- ErbB signaling pathway (68)
- Jak-STAT signaling pathway (68)
- Pancreatic cancer (63)
- Notch signaling pathway (57)
- Non-small cell lung cancer (56)
- Regulation of actin cytoskeleton (56)
- Leukocyte transendothelial migration (52)
- Primary immunodeficiency (52)
- Homologous recombination (51)
- Acute myeloid leukemia (50)
- Progesterone-mediated oocyte maturation (47)
- Glioma (46)
- Melanoma (46)
- Chemokine signaling pathway (45)
- Endocytosis (44)
- T cell receptor signaling pathway (43)
- Fc gamma R-mediated phagocytosis (40)
- Proteasome (38)
- Oocyte meiosis (36)
- VEGF signaling pathway (36)
- Type I diabetes mellitus (34)
- Cardiac muscle contraction (33)
- Dilated cardiomyopathy (33)
- Hypertrophic cardiomyopathy (HCM) (33)
- Natural killer cell mediated cytotoxicity (32)
- TGF-beta signaling pathway (31)
- Basal cell carcinoma (29)
- Viral myocarditis (29)
- Antigen processing and presentation (28)
- Calcium signaling pathway (27)
- Non-homologous end-joining (26)
- Drug metabolism - other enzymes (23)
- NOD-like receptor signaling pathway (23)
- One carbon pool by folate (23)
- Axon guidance (22)
- Ubiquitin mediated proteolysis (22)
- Renal cell carcinoma (16)
- Spliceosome (16)
- Alzheimer's disease (13)
- SNARE interactions in vesicular transport (13)
- B cell receptor signaling pathway (12)
- Epithelial cell signaling in Helicobacter pylori infection (12)
- Gap junction (12)
- Insulin signaling pathway (11)
- Parkinson's disease (11)
- Cysteine and methionine metabolism (10)
- Glycine (10)
- serine and threonine metabolism (10)
- Folate biosynthesis (9)
- Type II diabetes mellitus (9)
- Cytosolic DNA-sensing pathway (8)
- Prion diseases (8)
- Adipocytokine signaling pathway (7)
- Cytokine-cytokine receptor interaction (7)
- Hematopoietic cell lineage (7)
- Melanogenesis (7)
- RIG-I-like receptor signaling pathway (7)
- Adherens junction (5)
- Alanine (5)
- Arginine and proline metabolism (5)
- Phenylalanine (5)
- Phenylalanine metabolism (5)
- Tyrosine metabolism (5)
- aspartate and glutamate metabolism (5)
- tyrosine and tryptophan biosynthesis (5)
- Basal transcription factors (3)
- Pathogenic Escherichia coli infection (3)
- Systemic lupus erythematosus (3)
- Ether lipid metabolism (2)
- Fructose and mannose metabolism (2)
- Glycerolipid metabolism (2)
- Glycerophospholipid metabolism (2)
- Glycolysis / Gluconeogenesis (2)
- Pentose phosphate pathway (2)
- Sphingolipid metabolism (2)
- ECM-receptor interaction (1)
- Glyoxylate and dicarboxylate metabolism (1)
- Nicotinate and nicotinamide metabolism (1)
- RNA polymerase (1)
- Steroid biosynthesis (1)