Antibodies

Download

Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit monoclonal anti-Sox2 Antibody, clone OTIR094F2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Goat Anti-GATA3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence EVTADQPRWVSHH-C, from the N Terminus of the protein sequence according to NP_001002295.1; NP_002042.1.

Chicken Polyclonal MAP2 Antibody

Applications IF, WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified MAP2 isolated from bovine brain.

Oct4 (POU5F1) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 200-250 of Human Oct-3/4.

Mouse Monoclonal ApoE4 Antibody (4E4)

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-BDNF

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)VLEKVPVSKQLK, corresponding to amino acid residues 166-178 of human BDNF (precursor).

Rabbit Monoclonal antibody against Gli-1 (GLI1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal EGFR (Ab-1172) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q).

HDAC1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen N term -peptide of human HDAC1

PAX3 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PAX3

Rabbit Polyclonal Anti-BDNF Antibody

Applications IHC, WB
Reactivities Human, Macaque, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG

Anti-HES1 mouse mAb, clone OTI4H1, Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

Anti-HES1 mouse mAb, clone OTI4H1, HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

Rabbit Monoclonal Antibody against NOTCH1 (Clone EP1238Y)

Applications IF, IHC, WB
Reactivities Human, Mouse, Cow
Conjugation Unconjugated

Rabbit polyclonal anti-BDNF antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This IgG fraction antibody was prepared from rabbit antiserum after repeated immunizations with recombinant truncated human BDNF protein produced in E.coli.

BMP6 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 125-170 of Human BMP-6.

Rabbit Polyclonal Anti-HNF1A Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNF1A antibody: synthetic peptide directed towards the N terminal of human HNF1A. Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE

Anti-POU5F1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 1-150 amino acids of human POU class 5 homeobox 1

Goat Polyclonal Antibody against DKK1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CDHHQASNSSRLHT, from the C Terminus of the protein sequence according to NP_036374.

Rabbit Polyclonal Gli1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human Gli1 protein (between residues 150-200) [UniProt P08151]

Rabbit Polyclonal CD4 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Rabbit
Conjugation Unconjugated
Immunogen A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730]

Mouse Monoclonal MAP2 (N-terminus) Antibody

Applications IF, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit Polyclonal Anti-CDX2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CDX2 antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of human CDX2.

BMP2 (aa 261-290) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 261-290 of Human BMP2.

Rabbit anti-BDNF Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BDNF

Rabbit anti-CD44 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human CD44

Rabbit anti-CD9 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CD9

Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA
CD4

USD 300.00

In Stock

Goat Polyclonal Anti-CD4 Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within 50 to 235 aa, corresponding to the external domain of human CD4 produced in E. coli.

Mouse Monoclonal Antibody against SOX2

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal Neuro D (Ser274) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Neuro D around the phosphorylation site of serine 274 (P-L-SP-P-P).
Modifications Phospho-specific

Rabbit Polyclonal CD44 (Ser706) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CD44 around the phosphorylation site of Serine 706
Modifications Phospho-specific

Rabbit Polyclonal Anti-proBDNF

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)DEDQKVRPNEENNKDAD, corresponding to amino acid residues 72-88 of human BDNF (precursor). Pro-domain of the BDNF protein.

Rabbit Polyclonal Anti-SOX9 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SOX9 antibody: synthetic peptide directed towards the C terminal of human SOX9. Synthetic peptide located within the following region: AGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQ

Rabbit Polyclonal Anti-WNT3A Antibody - N-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT3A antibody: synthetic peptide directed towards the N terminal of human WNT3A. Synthetic peptide located within the following region: MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP

Rabbit Polyclonal Anti-BMP6 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BMP6 antibody: synthetic peptide directed towards the N terminal of human BMP6. Synthetic peptide located within the following region: DGGSPGRTEQPPPSPQSSSGFLYRRLKTQEKREMQKEILSVLGLPHRPRP

WNT3A mouse monoclonal antibody, clone 3A6, Purified

Applications ELISA, IHC, WB
Reactivities Human

Goat Polyclonal Antibody against FGF21

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CQRPDGALYGSLH, from the internal region of the protein sequence according to NP_061986.1.

Chicken Anti-Microtubule Associated Protein 2 (MAP2) Antibody

Applications WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Bovine MAP2 isolated from brain by the GTP microtubule cycling method

BMP4 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Chicken, Human, Mouse, Rabbit, Rat
Immunogen Synthetic peptide surrounding amino acid 395 of Human BMP-4

Rabbit Monoclonal Antibody against CD8A (Clone EP1150Y)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Antibody against SOX2 - Embryonic Stem Cell Marker

Applications FC, IHC, WB
Reactivities Human, Mouse, Sheep
Conjugation Unconjugated
Immunogen A synthetic peptide made to the N-terminal region of human SOX2 protein (within residues 1-100). [Swiss-Prot# P48431]

Rabbit Polyclonal Antibody against CD8A (N-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 59-88 amino acids from the N-terminal region of human CD8A.

Goat Polyclonal Antibody against APOE

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-VGTSAAPVPSDNH, from the C Terminus of the protein sequence according to NP_000032.1.

Anti-Human EGF Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived recombinant Human EGF

Goat Polyclonal Anti-Histone Deacetylase 1 Antibody

Applications WB
Reactivities Human, Mouse (Expected from sequence similarity: Rat, Dog)
Conjugation Unconjugated
Immunogen The immunogen for Anti-Histone Deacetylase 1 Antibody: Peptide with sequence C-KPEAKGVKEEVK, from the C Terminus of the protein sequence according to NP_004955.2.

Rabbit Polyclonal Anti-DEPTOR Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen DEPTOR antibody was raised against a 16 amino acid peptide near the center of human DEPTOR.