Germany
Japan
United Kingdom
China
Antibodies
View as table Download
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Goat Anti-Neurofascin / NFASC (aa877-890) Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NFSPNQTKFTVQRT, from the internal region of the protein sequence according to NP_001005388.2; NP_001153803.1; NP_001153804.1; NP_055905.2;. |
Rabbit polyclonal SLC11A2 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SLC11A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 262-291 amino acids from the Central region of human SLC11A2. |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal Anti-CD81 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
Rabbit Polyclonal Antibody against XCT
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
Rabbit Polyclonal STIM1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | STIM1 antibody was raised against a 24 amino acid synthetic peptide from near the carboxy terminus of human STIM1. The immunogen is located within the last 50 amino acids of STIM1. |
USD 380.00
2 Weeks
Rabbit Polyclonal Anti-HO-1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HO-1 Antibody: A synthesized peptide derived from human HO-1 |
Rabbit polyclonal HLA-G Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HLA-G antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the Central region of human HLA-G. |
Rabbit Polyclonal Antibody against SLC29A1 (Center)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ENT1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 234-263 amino acids from the Central region of human ENT1. |
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Antibody against CD19 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD19 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 143-172 amino acids from the N-terminal region of human CD19. |
Rabbit polyclonal PECAM-1 (Ab-713) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
N-cadherin Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human N-cadherin |
Rabbit Anti-NMDA NR2B Subunit Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the C-terminal region of the NR2B subunit |
Rabbit anti-UGT1A1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human UGT1A1 |
Active filters
Applications
- WB
Clonalities
- Polyclonal
Conjugates
- Unconjugated
Families
- Transmembrane
Citations
- Yes
Filter by
Category
Target Symbol
- CANX (6)
- BAX (3)
- PECAM1 (3)
- ABCC4 (2)
- ABCG2 (2)
- BDNF (2)
- CALCRL (2)
- CD4 (2)
- CD63 (2)
- CDH2 (2)
- ELOVL5 (2)
- G6PC (2)
- GJA1 (2)
- HMOX1 (2)
- KDR (2)
- SIGMAR1 (2)
- SLC11A2 (2)
- SLC2A1 (2)
- ABCB4 (1)
- ABCC2 (1)
- ABCC3 (1)
- ABCC5 (1)
- ABCC8 (1)
- ABCD3 (1)
- ACER1 (1)
- ACSL3 (1)
- ACSL4 (1)
- ADAM10 (1)
- ADAM17 (1)
- ADCY1 (1)
- AGPAT2 (1)
- ANTXR1 (1)
- APP (1)
- AQP4 (1)
- B3GLCT (1)
- BAK1 (1)
- BCL2L10 (1)
- BCL2L2 (1)
- BDKRB1 (1)
- CACNA1C (1)
- CADM4 (1)
- CAMP (1)
- CAV1 (1)
- CCR6 (1)
- CD19 (1)
- CD1E (1)
- CD274 (1)
- CD276 (1)
- CD44 (1)
- CD81 (1)
- CD8A (1)
- CDH3 (1)
- CDH5 (1)
- CDH8 (1)
- CHRM1 (1)
- CHRNA4 (1)
- CHSY1 (1)
- CLDN11 (1)
- CLDN2 (1)
- CPT1A (1)
- CUX1 (1)
- CX3CR1 (1)
- CYP3A4 (1)
- CYP7A1 (1)
- CYP8B1 (1)
- DBH (1)
- DDR1 (1)
- DIABLO (1)
- DPAGT1 (1)
- EDEM1 (1)
- EGFR (1)
- ERBB2 (1)
- ERN1 (1)
- EXT1 (1)
- FAIM2 (1)
- FAP (1)
- FFAR4 (1)
- FOLR1 (1)
- FZD2 (1)
- FZD9 (1)
- GABRA5 (1)
- GCNT3 (1)
- GP9 (1)
- GPD2 (1)
- GPER1 (1)
- GRIA1 (1)
- GRIK3 (1)
- GRIN2B (1)
- GRM2 (1)
- HAVCR1 (1)
- HCRTR1 (1)
- HLA-DRA (1)
- HLA-G (1)
- HSD11B1 (1)
- IFNB1 (1)
- IL17RB (1)
- IL1R1 (1)
- ITGA2B (1)
- ITGA4 (1)
- KCNH2 (1)
Reactivities
Antibody Hosts
Modifications
Pathways
- Cell adhesion molecules (CAMs) (20)
- Metabolic pathways (18)
- Neuroactive ligand-receptor interaction (18)
- Cytokine-cytokine receptor interaction (13)
- Hematopoietic cell lineage (13)
- Antigen processing and presentation (11)
- Pathways in cancer (11)
- ABC transporters (10)
- Alzheimer's disease (9)
- Calcium signaling pathway (9)
- Huntington's disease (9)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (8)
- Adipocytokine signaling pathway (7)
- Colorectal cancer (7)
- Focal adhesion (7)
- Leukocyte transendothelial migration (7)
- MAPK signaling pathway (7)
- Lysosome (6)
- Neurotrophin signaling pathway (6)
- Adherens junction (5)
- Amyotrophic lateral sclerosis (ALS) (5)
- Apoptosis (5)
- Dilated cardiomyopathy (5)
- ECM-receptor interaction (5)
- Endocytosis (5)
- PPAR signaling pathway (5)
- Parkinson's disease (5)
- Regulation of actin cytoskeleton (5)
- Vascular smooth muscle contraction (5)
- Gap junction (4)
- Hypertrophic cardiomyopathy (HCM) (4)
- Long-term potentiation (4)
- Primary immunodeficiency (4)
- Toll-like receptor signaling pathway (4)
- Viral myocarditis (4)
- Androgen and estrogen metabolism (3)
- Chemokine signaling pathway (3)
- Epithelial cell signaling in Helicobacter pylori infection (3)
- Fatty acid metabolism (3)
- GnRH signaling pathway (3)
- Melanogenesis (3)
- Natural killer cell mediated cytotoxicity (3)
- Pancreatic cancer (3)
- Porphyrin and chlorophyll metabolism (3)
- Prion diseases (3)
- Starch and sucrose metabolism (3)
- T cell receptor signaling pathway (3)
- p53 signaling pathway (3)
- Allograft rejection (2)
- Autoimmune thyroid disease (2)
- B cell receptor signaling pathway (2)
- Basal cell carcinoma (2)
- Biosynthesis of unsaturated fatty acids (2)
- Bladder cancer (2)
- Cardiac muscle contraction (2)
- Complement and coagulation cascades (2)
- Dorso-ventral axis formation (2)
- Drug metabolism - cytochrome P450 (2)
- Drug metabolism - other enzymes (2)
- Endometrial cancer (2)
- ErbB signaling pathway (2)
- Galactose metabolism (2)
- Glycerophospholipid metabolism (2)
- Glycolysis / Gluconeogenesis (2)
- Graft-versus-host disease (2)
- Insulin signaling pathway (2)
- Metabolism of xenobiotics by cytochrome P450 (2)
- Non-small cell lung cancer (2)
- Notch signaling pathway (2)
- Olfactory transduction (2)
- Oxidative phosphorylation (2)
- Primary bile acid biosynthesis (2)
- Prostate cancer (2)
- Renal cell carcinoma (2)
- Retinol metabolism (2)
- Systemic lupus erythematosus (2)
- Tight junction (2)
- Type I diabetes mellitus (2)
- Type II diabetes mellitus (2)
- VEGF signaling pathway (2)
- Wnt signaling pathway (2)
- Ascorbate and aldarate metabolism (1)
- Asthma (1)
- Axon guidance (1)
- C21-Steroid hormone metabolism (1)
- Chondroitin sulfate biosynthesis (1)
- Chronic myeloid leukemia (1)
- Cytosolic DNA-sensing pathway (1)
- Ether lipid metabolism (1)
- Glioma (1)
- Glycerolipid metabolism (1)
- Heparan sulfate biosynthesis (1)
- Jak-STAT signaling pathway (1)
- Linoleic acid metabolism (1)
- Long-term depression (1)
- Melanoma (1)
- N-Glycan biosynthesis (1)
- O-Glycan biosynthesis (1)
- Oocyte meiosis (1)
- Pathogenic Escherichia coli infection (1)
- Pentose and glucuronate interconversions (1)
- Progesterone-mediated oocyte maturation (1)
- Purine metabolism (1)
- RIG-I-like receptor signaling pathway (1)
- Renin-angiotensin system (1)
- SNARE interactions in vesicular transport (1)
- Small cell lung cancer (1)
- Sphingolipid metabolism (1)
- TGF-beta signaling pathway (1)
- Tyrosine metabolism (1)