Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal Anti-TMPRSS6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMPRSS6 antibody: synthetic peptide directed towards the N terminal of human TMPRSS6. Synthetic peptide located within the following region: LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK |
Rabbit Polyclonal Anti-FZD7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD7 antibody: synthetic peptide directed towards the C terminal of human FZD7. Synthetic peptide located within the following region: PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-BDNF antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IgG fraction antibody was prepared from rabbit antiserum after repeated immunizations with recombinant truncated human BDNF protein produced in E.coli. |
Rabbit Polyclonal Anti-SIDT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SIDT2 antibody: synthetic peptide directed towards the N terminal of human SIDT2. Synthetic peptide located within the following region: LNKQKGAPLLFVVRQKEAVVSFQVPLILRGMFQRKYLYQKVERTLCQPPT |
Rabbit Polyclonal Anti-SLC6A2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC6A2 antibody: synthetic peptide directed towards the middle region of human SLC6A2. Synthetic peptide located within the following region: STLSGSTFWAVVFFVMLLALGLDSSMGGMEAVITGLADDFQVLKRHRKLF |
Rabbit Polyclonal Antibody against CD19 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD19 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 143-172 amino acids from the N-terminal region of human CD19. |
Rabbit polyclonal PECAM-1 (Ab-713) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
N-cadherin Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human N-cadherin |
Rabbit Polyclonal Anti-NEU1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NEU1 antibody: synthetic peptide directed towards the middle region of human NEU1. Synthetic peptide located within the following region: VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG |
Rabbit Polyclonal Anti-OR51E2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR51E2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR51E2. Synthetic peptide located within the following region: VRVVMGDIYLLLPPVINPIIYGAKTKQIRTRVLAMFKISCDKDLQAVGGK |
Goat Polyclonal Anti-CD45 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 1,260 aa to the C-terminus of human CD45 produced in E. coli. |
Goat Anti-APOL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NNNYKILQADQE, from the C Terminus of the protein sequence according to NP_003652.2; NP_663318.1. |
Rabbit Anti-NMDA NR2B Subunit Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the C-terminal region of the NR2B subunit |
Rabbit anti-ABHD6 polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human ABHD6. |
Rabbit polyclonal anti-MBTPS1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human MBTPS1. |
Rabbit anti-IL7R Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL7R |
Rabbit anti-SLC3A2 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SLC3A2 |
Rabbit anti-UGT1A1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human UGT1A1 |
Rabbit Polyclonal Anti-SLC39A4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC39A4 Antibody: synthetic peptide directed towards the N terminal of human SLC39A4. Synthetic peptide located within the following region: PQCLSVEDALGLGEPEGSGLPPGPVLEARYVARLSAAAVLYLSNPEGTCE |
Rabbit Polyclonal Anti-KLB Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KLB antibody: synthetic peptide directed towards the middle region of human KLB. Synthetic peptide located within the following region: DAYTIRRGLFYVDFNSKQKERKPKSSAHYYKQIIRENGFSLKESTPDVQG |
Rabbit Polyclonal Anti-ABCB4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABCB4 antibody: synthetic peptide directed towards the N terminal of human ABCB4. Synthetic peptide located within the following region: AGAVAEEALGAIRTVIAFGGQNKELERYQKHLENAKEIGIKKAISANISM |
Rabbit Polyclonal Anti-NOTCH2 (Cleaved-Ala1734) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NOTCH2 (Cleaved-Ala1734) Antibody: A synthesized peptide derived from human NOTCH2 (Cleaved-Ala1734) |
Goat Polyclonal Anti-CD19 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide within residues 510 aa to the C-terminus of human CD19 produced in E. coli. |
Active filters
Reactivities
- Human
Applications
- WB
Clonalities
- Polyclonal
Families
- Transmembrane
Filter by
Target Symbol
- EGFR (36)
- ERBB2 (22)
- KDR (18)
- APP (16)
- CSF1R (16)
- BCL2 (15)
- CANX (15)
- BAX (13)
- BCL2L1 (13)
- FGFR1 (13)
- IGF1R (13)
- MET (13)
- AIFM1 (11)
- CAV1 (11)
- GJA1 (11)
- ICAM1 (11)
- KIT (11)
- NGFR (11)
- P2RX2 (11)
- PDGFRB (11)
- CLDN7 (10)
- CXCR4 (10)
- GRIN2B (10)
- PECAM1 (10)
- TNFSF11 (10)
- CDH1 (9)
- CLDN1 (9)
- CYP2D6 (9)
- EPHA2 (9)
- EPOR (9)
- ITGB3 (9)
- MCL1 (9)
- ORAI1 (9)
- PTGS1 (9)
- SCARB2 (9)
- SOX1 (9)
- ADRA1B (8)
- ADRB2 (8)
- CD19 (8)
- CD247 (8)
- CYP1A1 (8)
- DIABLO (8)
- F2R (8)
- MUC1 (8)
- NOTCH2 (8)
- NRG1 (8)
- NTRK2 (8)
- P2RY2 (8)
- SCARB1 (8)
- TRPM8 (8)
- ABCD4 (7)
- ACVR1 (7)
- AGER (7)
- ANTXR1 (7)
- BAK1 (7)
- BDNF (7)
- CAV2 (7)
- CD44 (7)
- CHRM1 (7)
- COX4I1 (7)
- EFNB2 (7)
- F10 (7)
- GRIN1 (7)
- GRM3 (7)
- HAVCR1 (7)
- HTR1A (7)
- HTR3A (7)
- KITLG (7)
- LYVE1 (7)
- MME (7)
- MST1R (7)
- S1PR1 (7)
- TGFBR2 (7)
- TLR3 (7)
- TLR4 (7)
- TNFSF10 (7)
- TNFSF13 (7)
- ACPP (6)
- ADAM17 (6)
- ALDH6A1 (6)
- ASPH (6)
- BCAP31 (6)
- CASR (6)
- CCR7 (6)
- CD70 (6)
- CD9 (6)
- CDH2 (6)
- CERS5 (6)
- CLDN11 (6)
- CLDN4 (6)
- CRHR2 (6)
- CUX1 (6)
- CX3CR1 (6)
- CYP3A4 (6)
- DBH (6)
- DDR1 (6)
- DHODH (6)
- EDA (6)
- EPHA3 (6)
- ERN1 (6)
Antibody Hosts
Conjugates
Modifications
Pathways
- Neuroactive ligand-receptor interaction (693)
- Cytokine-cytokine receptor interaction (556)
- Metabolic pathways (472)
- Pathways in cancer (365)
- Calcium signaling pathway (350)
- Olfactory transduction (323)
- Cell adhesion molecules (CAMs) (316)
- Hematopoietic cell lineage (231)
- Endocytosis (226)
- Focal adhesion (213)
- Regulation of actin cytoskeleton (183)
- MAPK signaling pathway (173)
- Colorectal cancer (161)
- Leukocyte transendothelial migration (152)
- Adherens junction (145)
- Alzheimer's disease (143)
- Prostate cancer (130)
- Jak-STAT signaling pathway (125)
- Melanoma (119)
- Axon guidance (118)
- Natural killer cell mediated cytotoxicity (116)
- Gap junction (108)
- Dilated cardiomyopathy (104)
- Pancreatic cancer (104)
- Melanogenesis (102)
- Apoptosis (97)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (96)
- Chemokine signaling pathway (94)
- Epithelial cell signaling in Helicobacter pylori infection (93)
- Amyotrophic lateral sclerosis (ALS) (92)
- ErbB signaling pathway (92)
- Hypertrophic cardiomyopathy (HCM) (91)
- Antigen processing and presentation (87)
- ABC transporters (86)
- ECM-receptor interaction (85)
- Vascular smooth muscle contraction (83)
- Huntington's disease (81)
- Tight junction (81)
- Viral myocarditis (80)
- Bladder cancer (78)
- Neurotrophin signaling pathway (74)
- Toll-like receptor signaling pathway (74)
- Glioma (73)
- Retinol metabolism (73)
- Endometrial cancer (72)
- Lysosome (72)
- Drug metabolism - cytochrome P450 (71)
- Wnt signaling pathway (70)
- Non-small cell lung cancer (66)
- Basal cell carcinoma (64)
- Systemic lupus erythematosus (62)
- GnRH signaling pathway (61)
- Parkinson's disease (61)
- Graft-versus-host disease (58)
- Adipocytokine signaling pathway (57)
- TGF-beta signaling pathway (56)
- Metabolism of xenobiotics by cytochrome P450 (54)
- PPAR signaling pathway (53)
- Primary immunodeficiency (52)
- Autoimmune thyroid disease (51)
- Notch signaling pathway (49)
- Allograft rejection (48)
- N-Glycan biosynthesis (48)
- Oxidative phosphorylation (48)
- Drug metabolism - other enzymes (47)
- Small cell lung cancer (47)
- Cardiac muscle contraction (46)
- Long-term potentiation (46)
- SNARE interactions in vesicular transport (46)
- Dorso-ventral axis formation (44)
- T cell receptor signaling pathway (42)
- Type I diabetes mellitus (42)
- Complement and coagulation cascades (41)
- Glycerophospholipid metabolism (41)
- Arachidonic acid metabolism (40)
- Androgen and estrogen metabolism (39)
- Long-term depression (39)
- Chronic myeloid leukemia (38)
- Vibrio cholerae infection (38)
- Asthma (37)
- Pathogenic Escherichia coli infection (37)
- Purine metabolism (37)
- p53 signaling pathway (37)
- Hedgehog signaling pathway (36)
- Taste transduction (35)
- Renal cell carcinoma (34)
- Renin-angiotensin system (34)
- Sphingolipid metabolism (34)
- Glycerolipid metabolism (32)
- Fatty acid metabolism (31)
- Porphyrin and chlorophyll metabolism (31)
- B cell receptor signaling pathway (29)
- Tyrosine metabolism (29)
- Progesterone-mediated oocyte maturation (28)
- Linoleic acid metabolism (26)
- O-Glycan biosynthesis (26)
- Pyrimidine metabolism (26)
- Starch and sucrose metabolism (26)
- Fc gamma R-mediated phagocytosis (25)
- Oocyte meiosis (25)
- Prion diseases (25)
- Ascorbate and aldarate metabolism (23)
- Ether lipid metabolism (23)
- Keratan sulfate biosynthesis (23)
- Heparan sulfate biosynthesis (22)
- Tryptophan metabolism (22)
- Glycosphingolipid biosynthesis - lacto and neolacto series (21)
- Type II diabetes mellitus (21)
- VEGF signaling pathway (21)
- Chondroitin sulfate biosynthesis (20)
- Pentose and glucuronate interconversions (20)
- Acute myeloid leukemia (19)
- Biosynthesis of unsaturated fatty acids (19)
- RIG-I-like receptor signaling pathway (19)
- Glutathione metabolism (18)
- Glycosphingolipid biosynthesis - ganglio series (18)
- Riboflavin metabolism (18)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (17)
- Insulin signaling pathway (17)
- Caffeine metabolism (16)
- Fc epsilon RI signaling pathway (16)
- Thyroid cancer (16)
- Primary bile acid biosynthesis (14)
- Cytosolic DNA-sensing pathway (13)
- Nicotinate and nicotinamide metabolism (12)
- Steroid biosynthesis (12)
- Glycosphingolipid biosynthesis - globo series (11)
- Propanoate metabolism (11)
- Valine (11)
- leucine and isoleucine degradation (11)
- Arginine and proline metabolism (9)
- C21-Steroid hormone metabolism (9)
- Cell cycle (9)
- Glycine (9)
- Glycosaminoglycan degradation (9)
- Histidine metabolism (9)
- NOD-like receptor signaling pathway (9)
- Nitrogen metabolism (9)
- Ubiquitin mediated proteolysis (9)
- serine and threonine metabolism (9)
- Phenylalanine metabolism (8)
- beta-Alanine metabolism (8)
- Lysine degradation (7)
- Amino sugar and nucleotide sugar metabolism (6)
- Cyanoamino acid metabolism (6)
- Galactose metabolism (6)
- Glycolysis / Gluconeogenesis (6)
- Inositol phosphate metabolism (6)
- Limonene and pinene degradation (6)
- Selenoamino acid metabolism (6)
- Taurine and hypotaurine metabolism (6)
- Base excision repair (5)
- Butanoate metabolism (5)
- Phosphatidylinositol signaling system (5)
- Pyruvate metabolism (5)
- O-Mannosyl glycan biosynthesis (4)
- alpha-Linolenic acid metabolism (4)
- Sulfur metabolism (3)
- Maturity onset diabetes of the young (2)
- Other glycan degradation (2)
- Terpenoid backbone biosynthesis (2)
- Citrate cycle (TCA cycle) (1)
- Pantothenate and CoA biosynthesis (1)
- Protein export (1)