Germany
Japan
United Kingdom
China
CD61 (ITGB3) mouse monoclonal antibody, clone VIPL2, Aff - Purified
| Applications | FC, IHC, WB |
| Reactivities | Human, Primate |
Antibodies
View as table Download
Goat Anti-CACNA1C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RARGRPSEEELQD, from the C Terminus of the protein sequence according to NP_000710.5. |
Rabbit Polyclonal Anti-TPM1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPM1 antibody: synthetic peptide directed towards the N terminal of human TPM1. Synthetic peptide located within the following region: DRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQE |
Rabbit Polyclonal Anti-DES Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DES antibody: synthetic peptide directed towards the middle region of human DES. Synthetic peptide located within the following region: MALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKT |
Rabbit Polyclonal Anti-GNAS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: NPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQ |
Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514) |
Lamin A (LMNA) mouse monoclonal antibody, clone R27, Supernatant
| Applications | IF, IHC, WB |
| Reactivities | Bovine, Fish, Human, Mouse, Rat, Xenopus, Zebrafish |
Rabbit polyclonal ITGB4 (Ab-1510) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human ITGB4 around the phosphorylation site of tyrosine 1510 (R-D-YP-S-T). |
Rabbit anti-GNAS Polyclonal Antibody
| Applications | ICC/IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GNAS |
Rabbit Polyclonal Anti-ADCY6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADCY6 antibody: synthetic peptide directed towards the C terminal of human ADCY6. Synthetic peptide located within the following region: LIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKY |
Goat Polyclonal Anti-cardiac troponin T Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Feline, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-cardiac troponin T Antibody: Peptide with sequence C-RNRINDNQKVSKT, from the C Terminus of the protein sequence according to NP_000355.2; NP_001001430.1; NP_001001431.1; NP_001001432.1. |
Rabbit polyclonal antibody to PRKACA (protein kinase, cAMP-dependent, catalytic, alpha)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 351 of PKA C alpha (Uniprot ID#P17612) |
ITGAV Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human ITGAV |
Integrin alpha 3 (ITGA3) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 500-550 of Human Integrin α3 |
Rabbit polyclonal PKA alpha/beta CAT (Thr197) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKA a/β CAT around the phosphorylation site of threonine 197 (T-W-TP-L-C). |
| Modifications | Phospho-specific |
Rabbit anti-IGF1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human IGF1 |
Rabbit Polyclonal Anti-TPM1 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPM1 antibody: synthetic peptide directed towards the middle region of human TPM1. Synthetic peptide located within the following region: LKEAETRAEFAERSVTKLEKSIDDLEDQLYQQLEQNRRLTNELKLALNED |
Rabbit Polyclonal Anti-DES Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DES antibody: synthetic peptide directed towards the N terminal of human DES. Synthetic peptide located within the following region: PLSSPVFPRAGFGSKGSSSSVTSRVYQVSRTSGGAGGLGSLRASRLGTTR |
Rabbit Polyclonal Anti-Integrin a5 (CD49e) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Integrin a5 (CD49e) Antibody: A synthesized peptide derived from human Integrin a5 (CD49e) |
Goat Polyclonal Anti-LMNA Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide within residues 620 aa to C-term of human LMNA produced in E. coli. |
TPM1 (Sarcomeric) mouse monoclonal antibody, clone ST-39, Purified
| Applications | IF, IHC, IP, WB |
| Reactivities | Chicken, Human, Rabbit, Rat |
USD 390.00
2 Weeks
Integrin alpha 3 (ITGA3) (3A Isoform specific) mouse monoclonal antibody, clone 29A3, Purified
| Applications | IF, IHC, WB |
| Reactivities | Human |
USD 390.00
2 Weeks
USD 390.00
2 Weeks
Integrin alpha 3 (ITGA3) (3B Isoform specific) mouse monoclonal antibody, clone 54B3, Purified
| Applications | IF, IHC, WB |
| Reactivities | Human |
Active filters
Applications
- WB
Families
- Druggable Genome
Pathways
- Dilated cardiomyopathy
Filter by
Category
Target Symbol
- TNNI3 (55)
- TNNT2 (55)
- GNAS (46)
- TNF (38)
- LMNA (35)
- SHC1 (32)
- IGF1 (27)
- DES (19)
- TGFB1 (18)
- CACNB2 (17)
- ITGB1 (17)
- ITGB3 (14)
- CACNB1 (12)
- TPM1 (9)
- ATP2A2 (8)
- ITGA4 (8)
- PRKACA (8)
- ITGAV (7)
- ITGB4 (7)
- ITGA5 (6)
- ITGA6 (6)
- CACNB4 (5)
- EMD (5)
- ITGB5 (5)
- ITGB6 (5)
- TGFB2 (5)
- TGFB3 (5)
- ADRB1 (4)
- CACNG1 (4)
- ITGA3 (4)
- MYL3 (4)
- PRKACB (4)
- ADCY1 (3)
- ADCY2 (3)
- CACNA2D1 (3)
- CACNA2D2 (3)
- CACNA2D4 (3)
- CACNB3 (3)
- CACNG4 (3)
- CACNG5 (3)
- CACNG6 (3)
- ITGA2 (3)
- ITGA2B (3)
- PRKX (3)
- SGCB (3)
- ADCY3 (2)
- ADCY4 (2)
- ADCY5 (2)
- ADCY6 (2)
- CACNA1C (2)
- DAG1 (2)
- ITGA1 (2)
- ITGA8 (2)
- ITGB7 (2)
- SGCG (2)
- ADCY8 (1)
- ADCY9 (1)
- CACNA1S (1)
- CACNA2D3 (1)
- CACNG3 (1)
- CACNG7 (1)
- CACNG8 (1)
- ITGA11 (1)
- ITGA7 (1)
- ITGB8 (1)
- MYBPC3 (1)
- PRKACG (1)
- RYR2 (1)
- SGCA (1)